VDAC2 Antibody

Novus Biologicals | Catalog # NBP2-20850

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Predicted:

Bovine (100%), Chicken (91%), Porcine (99%), Rabbit (100%), Rat (96%), Rhesus Macaque (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG
Loading...

Product Specifications

Immunogen

Recombinant protein encompassing a sequence within the center region of human VDAC2. The exact sequence is proprietary.

Reactivity Notes

Zebrafish (83%), Xenopus laevis (86%).

Localization

Mitochondrion outer membrane

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for VDAC2 Antibody

Western Blot: VDAC2 Antibody [NBP2-20850]

Western Blot: VDAC2 Antibody [NBP2-20850]

Western Blot: VDAC2 Antibody [NBP2-20850] - Sample (30 ug of whole cell lysate) A: HepG2 B: HCT116 12% SDS PAGE gel, diluted at 1:1000.
Immunohistochemistry-Paraffin: VDAC2 Antibody [NBP2-20850]

Immunohistochemistry-Paraffin: VDAC2 Antibody [NBP2-20850]

Immunohistochemistry-Paraffin: VDAC2 Antibody [NBP2-20850] - Immunohistochemical analysis of paraffin-embedded Colon ca, using antibody at 1:250 dilution.
VDAC2 Antibody

Western Blot: VDAC2 Antibody [NBP2-20850] -

Western Blot: VDAC2 Antibody [NBP2-20850] - Various tissue extracts (50 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with VDAC2 antibody [N1C2] (NBP2-20850) diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.

Applications for VDAC2 Antibody

Application
Recommended Usage

Immunohistochemistry

1:100-1:1000

Immunohistochemistry-Paraffin

1:100-1:1000

Western Blot

1:500-1:3000

Formulation, Preparation, and Storage

Purification

Antigen Affinity-purified

Formulation

PBS, 1% BSA, 20% Glycerol

Preservative

0.01% Thimerosal

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: VDAC2

This gene encodes a member of the voltage-dependent anion channel pore-forming family of proteins that are considered the main pathway for metabolite diffusion across the mitochondrial outer membrane. The encoded protein is also thought to be involved in the mitochondrial apoptotic pathway via regulation of BCL2-antagonist/killer 1 protein activity. Pseudogenes have been identified on chromosomes 1, 2, 12 and 21, and alternative splicing results in multiple transcript variants. [provided by RefSeq]

Alternate Names

FLJ23841, hVDAC2, Outer mitochondrial membrane protein porin 2, POR, VDAC-2, voltage-dependent anion channel 2, voltage-dependent anion-selective channel protein 2

Gene Symbol

VDAC2

UniProt

Additional VDAC2 Products

Product Documents for VDAC2 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for VDAC2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including mercury, which is known to the State of California to cause reproductive toxicity with developmental effects.  For more information go to www.P65Warnings.ca.gov.

Customer Reviews for VDAC2 Antibody

There are currently no reviews for this product. Be the first to review VDAC2 Antibody and earn rewards!

Have you used VDAC2 Antibody?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for VDAC2 Antibody

Showing  1 - 1 of 1 FAQ Showing All
  • Q: Could you tell me if this antibody has a chance to recognize the sea urchin sequence according to the amino acid identity with the immunogen? Here is the sequence of the sea urchin VDAC2: MAVPSSYSDLGKAARDIFGKGFGFGFVKLDAKTTTSNNVGFTVSSASNNDTGKVDASLETKYSWKE

    A: unfortunately, it does not look like we have any VDAC2 antibodies that I would recommend for use in sea urchin. A majority of our VDAC2 antibodies are made to the human sequence, which only shares 66% homology with the sea urchin sequence. While there are small spans of homology, I do not believe there is enough for recognition.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...