ω-Agatoxin IVA

  ( 4 citations )    
Product Datasheet
Catalog Number:2799
Alternate Names:ω-Aga-IV A
Chemical Name:
Product Details
Citations (4)
Reviews
Biological Activity
Selective blocker of P-type calcium channels (IC50 < 1 - 3 nM). Also inhibits N-type channels at micromolar concentrations.
Technical Data
  • M.Wt:
    5202.25
  • Formula:
    C217H360N68O60S10
  • Sequence:
    KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

    (Modifications: Disulfide bridge between 4 - 20, 12 - 25, 19 - 36, 27 - 34)

  • Solubility:
    Soluble in water
  • Storage:
    Desiccate at -20°C
  • CAS No:
    145017-83-0
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Product Datasheets
COA view current batch
or select another batch:
Citations:

The citations listed below are publications that use Tocris products. Selected citations for ω-Agatoxin IVA include:

4 Citations: Showing 1 - 4
Filter your results:

  1. Molecular basis of ancestral vertebrate electroreception.
    Authors: Bellono
    Nature  2017;543:391
  2. Synapsin II desynchronizes neurotransmitter release at inhibitory synapses by interacting with presynaptic calcium channels.
    Authors: Medrihan Et al.
    Nature  2013;4:1512
  3. The maturation of GABAergic transmission in visual cortex requires endocannabinoid-mediated LTD of inhibitory inputs during a critical period.
    Authors: Jiang Et al.
    Neuron  2010;66:248
  4. Competitive regulation of synaptic Ca2+ influx by D2 dopamine and A2A adenosine receptors.
    Authors: Higley and Sabatini
    Nat Neurosci  2010;13:958

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Have you used ω-Agatoxin IVA?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Contact Us to Order
reload

Feedback

Customer Information
Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee