ω-Agatoxin TK

Discontinued Product

2802 has been discontinued.
View all Cav2.x Channel Blockers products.
ω-Agatoxin TK
1 Image
Description: CaV2.1 blocker
Alternative Names: Agatoxin IVB

Purity: ≥95%

Product Details
Citations (5)
Reviews

Biological Activity

ω-Agatoxin TK is a selective blocker of CaV2.1 P/Q-type calcium channels.

Technical Data

M.Wt:
5273.02
Formula:
C215H337N65O70S10
Sequence:
EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA

(Modifications: Disulfide bridges: 4-20, 12-25, 19-36, 27-34)

Solubility:
Soluble in water
Purity:
≥95%
Storage:
Store at -20°C
CAS No:
158484-42-5

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Background References

  1. A novel type of calcium channel sensitive to ω-agatoxin-TK in cultured rat cerebral cortical neurons.
    Teramoto et al.
    Brain Res., 1997;756:225
  2. High-affinity inhibition of glutamate release from corticostriatal synapses by ω-agatoxin TK.
    Barral et al.
    Eur.J.Pharmacol., 2001;430:167
  3. A novel peptide from funnel web spider venom, ω-Aga-TK, selectively blocks P-type calcium channels.
    Teramoto et al.
    Biochem.Biophys.Res.Comms., 1993;196:134

Product Datasheets

Or select another batch:
View Batch
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Citations for ω-Agatoxin TK

The citations listed below are publications that use Tocris products. Selected citations for ω-Agatoxin TK include:

5 Citations: Showing 1 - 5

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for ω-Agatoxin TK

There are currently no reviews for this product. Be the first to review ω-Agatoxin TK and earn rewards!

Have you used ω-Agatoxin TK?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.