ω-Agatoxin TK

  ( 5 citations )    
Product Datasheet
Catalog Number:2802
Alternate Names:Agatoxin IVB
Chemical Name:
Product Details
Citations (5)
Reviews
Biological Activity
Selective blocker of CaV2.1 P/Q-type calcium channels.
Technical Data
  • M.Wt:
    5273.02
  • Formula:
    C215H337N65O70S10
  • Sequence:
    EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA

    (Modifications: Disulfide bridge between 4 - 20, 12 - 25, 19 - 36, 27 - 34)

  • Solubility:
    Soluble in water
  • Storage:
    Desiccate at -20°C
  • CAS No:
    158484-42-5
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Product Datasheets
COA view current batch
or select another batch:
Citations:

The citations listed below are publications that use Tocris products. Selected citations for ω-Agatoxin TK include:

5 Citations: Showing 1 - 5
Filter your results:

  1. Abnormal excitability and episodic low-frequency oscillations in the cerebral cortex of the tottering mouse.
    Authors: Cramer Et al.
    Neuropsychopharmacology  2015;35:5664
  2. Purkinje cell dysfunction and delayed death in plasma membrane calcium ATPase 2-heterozygous mice.
    Authors: Fakira Et al.
    J Neurosci  2012;51:22
  3. Concurrent imaging of synaptic vesicle recycling and calcium dynamics.
    Authors: Li Et al.
    Front Mol Neurosci  2011;4:34
  4. Activity-dependent relocation of the axon initial segment fine-tunes neuronal excitability.
    Authors: Grubb and Burrone
    Mol Cell Neurosci  2010;465:1070
  5. Sustained glutamate receptor activation down-regulates GABAB receptors by shifting the balance from recycling to lysosomal degradation.
    Authors: Maier Et al.
    J Biol Chem  2010;285:35606

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Have you used ω-Agatoxin TK?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Contact Us to Order
reload

Feedback

Customer Information
Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee