WASF2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-37912

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (92%), Rat (90%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all WASF2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: DSASSPSPSFSEDNLPPPPAEFSYPVDNQRGSGLAGPKRSSVVSPSHPPPAP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for WASF2 Antibody - BSA Free

Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912]

Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912]

Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912] - Analysis in human esophagus and skeletal muscle tissues. Corresponding WASF2 RNA-seq data are presented for the same tissues.
Immunocytochemistry/ Immunofluorescence: WASF2 Antibody [NBP2-37912]

Immunocytochemistry/ Immunofluorescence: WASF2 Antibody [NBP2-37912]

Immunocytochemistry/Immunofluorescence: WASF2 Antibody [NBP2-37912] - Staining of human cell line U-2 OS shows localization to plasma membrane. Antiibody staining is shown in green.
Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912]

Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912]

Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912] - Staining of human esophagus shows moderate cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912]

Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912]

Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912] - Staining of human placenta shows strong cytoplasmic positivity in endothelial cells.
Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912]

Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912]

Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912] - Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912]

Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912]

Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912] - Staining of human Fallopian tube shows moderate cytoplasmic positivity in glandular cells
Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912]

Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912]

Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912] - Staining of human skeletal muscle shows low positivity in myocytes as expected.

Applications for WASF2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: WASF2

WASF2 encodes a member of the Wiskott-Aldrich syndrome protein family. The gene product is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function. The published map location (PMID:10381382) has been changed based on recent genomic sequence comparisons, which indicate that the expressed gene is located on chromosome 1, and a pseudogene may be located on chromosome X.

Alternate Names

IMD2, Protein WAVE-2, SCAR2suppressor of cyclic-AMP receptor (WASP-family), Verprolin homology domain-containing protein 2, WAS protein family, member 2, WASP family Verprolin-homologous protein 2, WAVE2dJ393P12.2, wiskWASP family protein member 2

Gene Symbol

WASF2

UniProt

Q9Y6W5 (Human)

Additional WASF2 Products

Product Documents for WASF2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for WASF2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for WASF2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review WASF2 Antibody - BSA Free and earn rewards!

Have you used WASF2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies