WBP11 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54648

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all WBP11 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to WBP11(WW domain binding protein 11) The peptide sequence was selected from the N terminal of WBP11. Peptide sequence GRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

70 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for WBP11 Antibody - BSA Free

Western Blot: WBP11 Antibody [NBP1-54648]

Western Blot: WBP11 Antibody [NBP1-54648]

Western Blot: WBP11 Antibody [NBP1-54648] - Jurkat, Antibody Dilution: 1.0 ug/ml WBP11 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.

Immunohistochemistry-Paraffin: WBP11 Antibody [NBP1-54648] -

Immunohistochemistry-Paraffin: WBP11 Antibody [NBP1-54648] - Formalin Fixed Paraffin; Embedded Tissue: Human Pineal Tissue; Observed Staining: Cytoplasmic in cell bodies of pinealocytes and their processes; Primary Antibody Concentration: 1:100
Western Blot: WBP11 Antibody [NBP1-54648]

Western Blot: WBP11 Antibody [NBP1-54648]

Western Blot: WBP11 Antibody [NBP1-54648] - Titration: 2 ug/ml Positive Control: Mouse brain homogenate
Western Blot: WBP11 Antibody [NBP1-54648]

Western Blot: WBP11 Antibody [NBP1-54648]

Western Blot: WBP11 Antibody [NBP1-54648] - Hela cell lysate, concentration 0.2-1 ug/ml.
Western Blot: WBP11 Antibody [NBP1-54648]

Western Blot: WBP11 Antibody [NBP1-54648]

Western Blot: WBP11 Antibody [NBP1-54648] - Titration: 2 ug/ml Positive Control: Human NT-2 cells and Mouse WT brain.

Applications for WBP11 Antibody - BSA Free

Application
Recommended Usage

Immunoprecipitation

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: WBP11

WBP11 is a nuclear protein, which colocalizes with mRNA splicing factors and intermediate filament-containing perinuclear networks. WBP11has 95% amino acid sequence identity to the mouse Wbp11 protein. It contains two proline-rich regions that bind to the WW domain of Npw38, a nuclear protein, and thus this protein is also called Npw38-binding protein NpwBP. The Npw38-NpwBP complex may function as a component of an mRNA factory in the nucleus.This gene encodes a nuclear protein, which colocalizes with mRNA splicing factors and intermediate filament-containing perinuclear networks. This protein has 95% amino acid sequence identity to the mouse Wbp11 protein. It contains two proline-rich regions that bind to the WW domain of Npw38, a nuclear protein, and thus this protein is also called Npw38-binding protein NpwBP. The Npw38-NpwBP complex may function as a component of an mRNA factory in the nucleus.

Alternate Names

DKFZp779M1063, Npw38-binding protein, Npw38-binding protein NpwBP, NpwBP, NPWBPsplicing factor, PQBP1 and PP1 interacting, SH3 domain-binding protein SNP70, SIPP1WW domain-binding protein 11, SNP70, Splicing factor that interacts with PQBP-1 and PP1, WBP-11, WW domain binding protein 11

Gene Symbol

WBP11

UniProt

Q9Y2W2 (Human)

Additional WBP11 Products

Product Documents for WBP11 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for WBP11 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for WBP11 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review WBP11 Antibody - BSA Free and earn rewards!

Have you used WBP11 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies