WDR60 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-90437
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Knockdown Validated
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DIQTEEIETREVWTQHPGESTVVSGGSEQRDTSDAVVMPKIDTPRLCSFLRAACQVMAVLLEEDRLAAEPSWNLRAQDRALYFSDSSSQLNTSLPFLQNRKVSSLHTSRVQRQMVVSVH
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (82%).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for WDR60 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: WDR60 Antibody [NBP1-90437]
Immunocytochemistry/Immunofluorescence: WDR60 Antibody [NBP1-90437] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol & microtubule organizing center. Antibody staining is shown in green.Immunohistochemistry-Paraffin: WDR60 Antibody [NBP1-90437]
Immunohistochemistry-Paraffin: WDR60 Antibody [NBP1-90437] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.Immunocytochemistry/ Immunofluorescence: WDR60 Antibody [NBP1-90437] -
Dynein-2 assembly in primary cilium.(A) Immunoblotting for WDR60 & WDR34 in WT, WDR34 KO#1 & WDR60 KO cells. Arrows indicate WDR34 & WDR60 proteins. (B) LIC3/DYNC2LI1 localization in the cilia of WT, WDR34 KO#1 & WDR60 KO cells. (C) DHC2/DYNC2H1 localization at the ciliary base in WT & KO cells. (Ci) Intensity quantification shows a reduction of DHC2/DYNC2H1 at the ciliary base in WDR34 KO#1 cells (n = 3, 120 WT, 106 WDR60 KO, & 71 WDR34 KO #1 cells quantified). (D) TCTEX1/DYNLT1 localizes at the ciliary base in WT & KO cells. (Di) Intensity quantification of TCTEX1/DYNLT1 at the ciliary base (n = 3 115 WT, 85 WDR60 KO, & 50 WDR34 KO#1 cells quantified). Mann-Whitney test, p-value: ****=<0.0001. Scale bars 5 μm. Arrows point to the ciliary base.Overexpression of WDR34 cannot rescue WDR60 KO phenotype & vice versa.(A) HA-WDR60 localization in WT & WDR34 KO cells. (Ai) Intensity quantification of HA-WDR60 in primary cilia (n = 3, 50 WT & 50 WDR34 KO cells quantified). Mann-Whitney test was used, p-value: ****=<0.0001. (B) HA-WDR34 localization in WT & WDR60 cells. For HA immunolabeling in Fig. A & B cells were treated with cytoskeletal buffer as described in methods. (C) Arl13b staining of WDR34 KO cells expressing HA-WDR60. HA labeling in green shows stable expression of HA-WDR60. (D) IFT88 localizes predominantly at the ciliary base in WT cells whereas WDR60 KO cells stably expressing HA-WDR34 accumulate IFT88 at the ciliary tip, similar to untransfected WDR60 KO cells. Scale bars 5 μm. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30320547), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunocytochemistry/ Immunofluorescence: WDR60 Antibody [NBP1-90437] -
Dynein-2 assembly in primary cilium.(A) Immunoblotting for WDR60 & WDR34 in WT, WDR34 KO#1 & WDR60 KO cells. Arrows indicate WDR34 & WDR60 proteins. (B) LIC3/DYNC2LI1 localization in the cilia of WT, WDR34 KO#1 & WDR60 KO cells. (C) DHC2/DYNC2H1 localization at the ciliary base in WT & KO cells. (Ci) Intensity quantification shows a reduction of DHC2/DYNC2H1 at the ciliary base in WDR34 KO#1 cells (n = 3, 120 WT, 106 WDR60 KO, & 71 WDR34 KO #1 cells quantified). (D) TCTEX1/DYNLT1 localizes at the ciliary base in WT & KO cells. (Di) Intensity quantification of TCTEX1/DYNLT1 at the ciliary base (n = 3 115 WT, 85 WDR60 KO, & 50 WDR34 KO#1 cells quantified). Mann-Whitney test, p-value: ****=<0.0001. Scale bars 5 μm. Arrows point to the ciliary base.Overexpression of WDR34 cannot rescue WDR60 KO phenotype & vice versa.(A) HA-WDR60 localization in WT & WDR34 KO cells. (Ai) Intensity quantification of HA-WDR60 in primary cilia (n = 3, 50 WT & 50 WDR34 KO cells quantified). Mann-Whitney test was used, p-value: ****=<0.0001. (B) HA-WDR34 localization in WT & WDR60 cells. For HA immunolabeling in Fig. A & B cells were treated with cytoskeletal buffer as described in methods. (C) Arl13b staining of WDR34 KO cells expressing HA-WDR60. HA labeling in green shows stable expression of HA-WDR60. (D) IFT88 localizes predominantly at the ciliary base in WT cells whereas WDR60 KO cells stably expressing HA-WDR34 accumulate IFT88 at the ciliary tip, similar to untransfected WDR60 KO cells. Scale bars 5 μm. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30320547), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunocytochemistry/ Immunofluorescence: WDR60 Antibody [NBP1-90437] -
Dynein-2 assembly in primary cilium.(A) Immunoblotting for WDR60 & WDR34 in WT, WDR34 KO#1 & WDR60 KO cells. Arrows indicate WDR34 & WDR60 proteins. (B) LIC3/DYNC2LI1 localization in the cilia of WT, WDR34 KO#1 & WDR60 KO cells. (C) DHC2/DYNC2H1 localization at the ciliary base in WT & KO cells. (Ci) Intensity quantification shows a reduction of DHC2/DYNC2H1 at the ciliary base in WDR34 KO#1 cells (n = 3, 120 WT, 106 WDR60 KO, & 71 WDR34 KO #1 cells quantified). (D) TCTEX1/DYNLT1 localizes at the ciliary base in WT & KO cells. (Di) Intensity quantification of TCTEX1/DYNLT1 at the ciliary base (n = 3 115 WT, 85 WDR60 KO, & 50 WDR34 KO#1 cells quantified). Mann-Whitney test, p-value: ****=<0.0001. Scale bars 5 μm. Arrows point to the ciliary base.Overexpression of WDR34 cannot rescue WDR60 KO phenotype & vice versa.(A) HA-WDR60 localization in WT & WDR34 KO cells. (Ai) Intensity quantification of HA-WDR60 in primary cilia (n = 3, 50 WT & 50 WDR34 KO cells quantified). Mann-Whitney test was used, p-value: ****=<0.0001. (B) HA-WDR34 localization in WT & WDR60 cells. For HA immunolabeling in Fig. A & B cells were treated with cytoskeletal buffer as described in methods. (C) Arl13b staining of WDR34 KO cells expressing HA-WDR60. HA labeling in green shows stable expression of HA-WDR60. (D) IFT88 localizes predominantly at the ciliary base in WT cells whereas WDR60 KO cells stably expressing HA-WDR34 accumulate IFT88 at the ciliary tip, similar to untransfected WDR60 KO cells. Scale bars 5 μm. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30320547), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for WDR60 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: WDR60
Alternate Names
FLJ10300, FLJ23575, WD repeat domain 60, WD repeat-containing protein 60
Gene Symbol
WDR60
Additional WDR60 Products
Product Documents for WDR60 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for WDR60 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for WDR60 Antibody - BSA Free
Customer Reviews for WDR60 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review WDR60 Antibody - BSA Free and earn rewards!
Have you used WDR60 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...