WDR60 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-90437

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: DIQTEEIETREVWTQHPGESTVVSGGSEQRDTSDAVVMPKIDTPRLCSFLRAACQVMAVLLEEDRLAAEPSWNLRAQDRALYFSDSSSQLNTSLPFLQNRKVSSLHTSRVQRQMVVSVH

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (82%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for WDR60 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: WDR60 Antibody [NBP1-90437]

Immunocytochemistry/ Immunofluorescence: WDR60 Antibody [NBP1-90437]

Immunocytochemistry/Immunofluorescence: WDR60 Antibody [NBP1-90437] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol & microtubule organizing center. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: WDR60 Antibody [NBP1-90437]

Immunohistochemistry-Paraffin: WDR60 Antibody [NBP1-90437]

Immunohistochemistry-Paraffin: WDR60 Antibody [NBP1-90437] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
WDR60 Antibody

Immunocytochemistry/ Immunofluorescence: WDR60 Antibody [NBP1-90437] -

Dynein-2 assembly in primary cilium.(A) Immunoblotting for WDR60 & WDR34 in WT, WDR34 KO#1 & WDR60 KO cells. Arrows indicate WDR34 & WDR60 proteins. (B) LIC3/DYNC2LI1 localization in the cilia of WT, WDR34 KO#1 & WDR60 KO cells. (C) DHC2/DYNC2H1 localization at the ciliary base in WT & KO cells. (Ci) Intensity quantification shows a reduction of DHC2/DYNC2H1 at the ciliary base in WDR34 KO#1 cells (n = 3, 120 WT, 106 WDR60 KO, & 71 WDR34 KO #1 cells quantified). (D) TCTEX1/DYNLT1 localizes at the ciliary base in WT & KO cells. (Di) Intensity quantification of TCTEX1/DYNLT1 at the ciliary base (n = 3 115 WT, 85 WDR60 KO, & 50 WDR34 KO#1 cells quantified). Mann-Whitney test, p-value: ****=<0.0001. Scale bars 5 μm. Arrows point to the ciliary base.Overexpression of WDR34 cannot rescue WDR60 KO phenotype & vice versa.(A) HA-WDR60 localization in WT & WDR34 KO cells. (Ai) Intensity quantification of HA-WDR60 in primary cilia (n = 3, 50 WT & 50 WDR34 KO cells quantified). Mann-Whitney test was used, p-value: ****=<0.0001. (B) HA-WDR34 localization in WT & WDR60 cells. For HA immunolabeling in Fig. A & B cells were treated with cytoskeletal buffer as described in methods. (C) Arl13b staining of WDR34 KO cells expressing HA-WDR60. HA labeling in green shows stable expression of HA-WDR60. (D) IFT88 localizes predominantly at the ciliary base in WT cells whereas WDR60 KO cells stably expressing HA-WDR34 accumulate IFT88 at the ciliary tip, similar to untransfected WDR60 KO cells. Scale bars 5 μm. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30320547), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
WDR60 Antibody

Immunocytochemistry/ Immunofluorescence: WDR60 Antibody [NBP1-90437] -

Dynein-2 assembly in primary cilium.(A) Immunoblotting for WDR60 & WDR34 in WT, WDR34 KO#1 & WDR60 KO cells. Arrows indicate WDR34 & WDR60 proteins. (B) LIC3/DYNC2LI1 localization in the cilia of WT, WDR34 KO#1 & WDR60 KO cells. (C) DHC2/DYNC2H1 localization at the ciliary base in WT & KO cells. (Ci) Intensity quantification shows a reduction of DHC2/DYNC2H1 at the ciliary base in WDR34 KO#1 cells (n = 3, 120 WT, 106 WDR60 KO, & 71 WDR34 KO #1 cells quantified). (D) TCTEX1/DYNLT1 localizes at the ciliary base in WT & KO cells. (Di) Intensity quantification of TCTEX1/DYNLT1 at the ciliary base (n = 3 115 WT, 85 WDR60 KO, & 50 WDR34 KO#1 cells quantified). Mann-Whitney test, p-value: ****=<0.0001. Scale bars 5 μm. Arrows point to the ciliary base.Overexpression of WDR34 cannot rescue WDR60 KO phenotype & vice versa.(A) HA-WDR60 localization in WT & WDR34 KO cells. (Ai) Intensity quantification of HA-WDR60 in primary cilia (n = 3, 50 WT & 50 WDR34 KO cells quantified). Mann-Whitney test was used, p-value: ****=<0.0001. (B) HA-WDR34 localization in WT & WDR60 cells. For HA immunolabeling in Fig. A & B cells were treated with cytoskeletal buffer as described in methods. (C) Arl13b staining of WDR34 KO cells expressing HA-WDR60. HA labeling in green shows stable expression of HA-WDR60. (D) IFT88 localizes predominantly at the ciliary base in WT cells whereas WDR60 KO cells stably expressing HA-WDR34 accumulate IFT88 at the ciliary tip, similar to untransfected WDR60 KO cells. Scale bars 5 μm. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30320547), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
WDR60 Antibody

Immunocytochemistry/ Immunofluorescence: WDR60 Antibody [NBP1-90437] -

Dynein-2 assembly in primary cilium.(A) Immunoblotting for WDR60 & WDR34 in WT, WDR34 KO#1 & WDR60 KO cells. Arrows indicate WDR34 & WDR60 proteins. (B) LIC3/DYNC2LI1 localization in the cilia of WT, WDR34 KO#1 & WDR60 KO cells. (C) DHC2/DYNC2H1 localization at the ciliary base in WT & KO cells. (Ci) Intensity quantification shows a reduction of DHC2/DYNC2H1 at the ciliary base in WDR34 KO#1 cells (n = 3, 120 WT, 106 WDR60 KO, & 71 WDR34 KO #1 cells quantified). (D) TCTEX1/DYNLT1 localizes at the ciliary base in WT & KO cells. (Di) Intensity quantification of TCTEX1/DYNLT1 at the ciliary base (n = 3 115 WT, 85 WDR60 KO, & 50 WDR34 KO#1 cells quantified). Mann-Whitney test, p-value: ****=<0.0001. Scale bars 5 μm. Arrows point to the ciliary base.Overexpression of WDR34 cannot rescue WDR60 KO phenotype & vice versa.(A) HA-WDR60 localization in WT & WDR34 KO cells. (Ai) Intensity quantification of HA-WDR60 in primary cilia (n = 3, 50 WT & 50 WDR34 KO cells quantified). Mann-Whitney test was used, p-value: ****=<0.0001. (B) HA-WDR34 localization in WT & WDR60 cells. For HA immunolabeling in Fig. A & B cells were treated with cytoskeletal buffer as described in methods. (C) Arl13b staining of WDR34 KO cells expressing HA-WDR60. HA labeling in green shows stable expression of HA-WDR60. (D) IFT88 localizes predominantly at the ciliary base in WT cells whereas WDR60 KO cells stably expressing HA-WDR34 accumulate IFT88 at the ciliary tip, similar to untransfected WDR60 KO cells. Scale bars 5 μm. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30320547), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for WDR60 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: WDR60

Alternate Names

FLJ10300, FLJ23575, WD repeat domain 60, WD repeat-containing protein 60

Gene Symbol

WDR60

Additional WDR60 Products

Product Documents for WDR60 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for WDR60 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for WDR60 Antibody - BSA Free

Customer Reviews for WDR60 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review WDR60 Antibody - BSA Free and earn rewards!

Have you used WDR60 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...