WDR74 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84623

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: GGEGMFRGLAQADGTLITCVDSGILRVWHDKDKDTSSDPLLELRVGPGVCRMRQDPAHPHVVATGGKENALKIWDL

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (84%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for WDR74 Antibody - BSA Free

Immunohistochemistry-Paraffin: WDR74 Antibody [NBP1-84623]

Immunohistochemistry-Paraffin: WDR74 Antibody [NBP1-84623]

Immunohistochemistry-Paraffin: WDR74 Antibody [NBP1-84623] - staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.
WDR74 Antibody - BSA Free Western Blot: WDR74 Antibody - BSA Free [NBP1-84623]

Western Blot: WDR74 Antibody - BSA Free [NBP1-84623]

Analysis in control (vector only transfected HEK293T lysate) and WDR74 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY413318).
WDR74 Antibody - BSA Free Western Blot: WDR74 Antibody - BSA Free [NBP1-84623]

Western Blot: WDR74 Antibody - BSA Free [NBP1-84623]

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4

Applications for WDR74 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: WDR74

WDR74, also known as WD repeat-containing protein 74, has a 385 amino acid long isoform that is 42 kDa and a short 366 amino acid isoform that is approx. 40 kDa, is located in the nucleolus and known to be required for RNA transcription, processing and/or stability during pre-implantation development and blastocyst formation in mouse. It is associated with Jervell and Lange-Nielsen syndrome, Jacobsen syndrome and Niemann-Pick disease. This protein has also shown to have an interaction with RGS2, CALR and NUDT3 in blastocyst formation, biological and RNA metabolic processes.

Alternate Names

FLJ10439, FLJ21730, NOP seven-associated protein 1, NSA1, WD repeat domain 74, WD repeat-containing protein 74

Gene Symbol

WDR74

Additional WDR74 Products

Product Documents for WDR74 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for WDR74 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for WDR74 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review WDR74 Antibody - BSA Free and earn rewards!

Have you used WDR74 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...