WHIP Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38190

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (98%), Rat (98%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: CKKSGQSYSPSRVLITENDVKEGLQRSHILYDRAGEEHYNCISALHKSMRGSDQNASLYWLARMLEGGEDPLYVARRLVRFAS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for WHIP Antibody - BSA Free

Immunohistochemistry-Paraffin: WHIP Antibody [NBP2-38190]

Immunohistochemistry-Paraffin: WHIP Antibody [NBP2-38190]

Immunohistochemistry-Paraffin: WHIP Antibody [NBP2-38190] - Staining of human cerebral cortex, liver, placenta and prostate using Anti-WRNIP1 antibody NBP2-38190 (A) shows similar protein distribution across tissues to independent antibody NBP1-90030 (B).
Western Blot: WHIP Antibody [NBP2-38190]

Western Blot: WHIP Antibody [NBP2-38190]

Western Blot: WHIP Antibody [NBP2-38190] - Analysis using Anti-WRNIP1 antibody NBP2-38190 (A) shows similar pattern to independent antibody NBP1-90030 (B).
Immunocytochemistry/ Immunofluorescence: WHIP Antibody [NBP2-38190]

Immunocytochemistry/ Immunofluorescence: WHIP Antibody [NBP2-38190]

Immunocytochemistry/Immunofluorescence: WHIP Antibody [NBP2-38190] - Staining of human cell line U-2 OS shows positivity in nucleus but excluded from the nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: WHIP Antibody [NBP2-38190]

Immunohistochemistry-Paraffin: WHIP Antibody [NBP2-38190]

Immunohistochemistry-Paraffin: WHIP Antibody [NBP2-38190] - Staining of human prostate shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: WHIP Antibody [NBP2-38190]

Immunohistochemistry-Paraffin: WHIP Antibody [NBP2-38190]

Immunohistochemistry-Paraffin: WHIP Antibody [NBP2-38190] - Staining of human cerebral cortex shows moderate nuclear positivity in neurons.
Immunohistochemistry-Paraffin: WHIP Antibody [NBP2-38190]

Immunohistochemistry-Paraffin: WHIP Antibody [NBP2-38190]

Immunohistochemistry-Paraffin: WHIP Antibody [NBP2-38190] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: WHIP Antibody [NBP2-38190]

Immunohistochemistry-Paraffin: WHIP Antibody [NBP2-38190]

Immunohistochemistry-Paraffin: WHIP Antibody [NBP2-38190] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.
WHIP Antibody - BSA Free

Western Blot: WHIP Antibody - BSA Free [NBP2-38190] -

siRNA knockdown efficiency of WRNIP1 and stable expression of WT and mutant WRN and WRNIP1 proteins.(A) (i) Schematic representation of WRNIP1 protein. The positions of UBZ, siRNA target site, the core ATPase domain, and the position of K274A mutation in this domain are indicated. (ii) The sequence of the conserved Walker A motif containing the ATP-binding-deficient K577A mutation in WRN or K274A mutation in WRNIP1 is shown. (iii) Western blot analyses of the efficiency of WRNIP1 knockdown in HFs and BBMEFs. (B) Western blot analyses of stable expression of WT and mutant WRN proteins in WRN-/- HFs (left) and BBMEFs (right). (C) Western blot analyses of stable expression of WT and mutant WRNIP1 proteins in WT HFs (left) and BBMEFs (right). (D) Western blot analyses of stable expression of combinations of WRN and WRNIP1 mutant proteins in WRN-/- HFs (left) and BBMEFs (right).Figure 1—figure supplement 1—source data 1.Original uncropped images for western blots shown in Figure 1—figure supplement 1.Figure 1—figure supplement 1—source data 2.Original uncropped images for western blots shown in Figure 1—figure supplement 1 (labelled).Original uncropped images for western blots shown in Figure 1—figure supplement 1.Original uncropped images for western blots shown in Figure 1—figure supplement 1 (labelled). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40900148), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for WHIP Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: WHIP

Werner's syndrome is a rare autosomal recessive disorder characterized by premature aging. The protein encoded by this gene interacts with the N-terminal portion of Werner protein containing the exonuclease domain. This protein shows homology to replication factor C family proteins, and is conserved from E. coli to human. Studies in yeast suggest that this gene may influence the aging process. Two transcript variants encoding different isoforms have been isolated for this gene.

Alternate Names

ATPase WRNIP1, bA420G6.2, EC 3.6.1, FLJ22526, putative helicase RUVBL, Werner helicase interacting protein 1, Werner helicase-interacting protein 1, WHIPRP11-420G6.2

Gene Symbol

WRNIP1

UniProt

Additional WHIP Products

Product Documents for WHIP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for WHIP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for WHIP Antibody - BSA Free

Customer Reviews for WHIP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review WHIP Antibody - BSA Free and earn rewards!

Have you used WHIP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...