WHIP Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-38190
Loading...
Key Product Details
Validated by
Independent Antibodies
Species Reactivity
Validated:
Human
Predicted:
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: CKKSGQSYSPSRVLITENDVKEGLQRSHILYDRAGEEHYNCISALHKSMRGSDQNASLYWLARMLEGGEDPLYVARRLVRFAS
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for WHIP Antibody - BSA Free
Immunohistochemistry-Paraffin: WHIP Antibody [NBP2-38190]
Immunohistochemistry-Paraffin: WHIP Antibody [NBP2-38190] - Staining of human cerebral cortex, liver, placenta and prostate using Anti-WRNIP1 antibody NBP2-38190 (A) shows similar protein distribution across tissues to independent antibody NBP1-90030 (B).Immunocytochemistry/ Immunofluorescence: WHIP Antibody [NBP2-38190]
Immunocytochemistry/Immunofluorescence: WHIP Antibody [NBP2-38190] - Staining of human cell line U-2 OS shows positivity in nucleus but excluded from the nucleoli. Antibody staining is shown in green.Immunohistochemistry-Paraffin: WHIP Antibody [NBP2-38190]
Immunohistochemistry-Paraffin: WHIP Antibody [NBP2-38190] - Staining of human prostate shows moderate nuclear positivity in glandular cells.Immunohistochemistry-Paraffin: WHIP Antibody [NBP2-38190]
Immunohistochemistry-Paraffin: WHIP Antibody [NBP2-38190] - Staining of human cerebral cortex shows moderate nuclear positivity in neurons.Immunohistochemistry-Paraffin: WHIP Antibody [NBP2-38190]
Immunohistochemistry-Paraffin: WHIP Antibody [NBP2-38190] - Staining of human liver shows no positivity in hepatocytes as expected.Immunohistochemistry-Paraffin: WHIP Antibody [NBP2-38190]
Immunohistochemistry-Paraffin: WHIP Antibody [NBP2-38190] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.Western Blot: WHIP Antibody - BSA Free [NBP2-38190] -
siRNA knockdown efficiency of WRNIP1 and stable expression of WT and mutant WRN and WRNIP1 proteins.(A) (i) Schematic representation of WRNIP1 protein. The positions of UBZ, siRNA target site, the core ATPase domain, and the position of K274A mutation in this domain are indicated. (ii) The sequence of the conserved Walker A motif containing the ATP-binding-deficient K577A mutation in WRN or K274A mutation in WRNIP1 is shown. (iii) Western blot analyses of the efficiency of WRNIP1 knockdown in HFs and BBMEFs. (B) Western blot analyses of stable expression of WT and mutant WRN proteins in WRN-/- HFs (left) and BBMEFs (right). (C) Western blot analyses of stable expression of WT and mutant WRNIP1 proteins in WT HFs (left) and BBMEFs (right). (D) Western blot analyses of stable expression of combinations of WRN and WRNIP1 mutant proteins in WRN-/- HFs (left) and BBMEFs (right).Figure 1—figure supplement 1—source data 1.Original uncropped images for western blots shown in Figure 1—figure supplement 1.Figure 1—figure supplement 1—source data 2.Original uncropped images for western blots shown in Figure 1—figure supplement 1 (labelled).Original uncropped images for western blots shown in Figure 1—figure supplement 1.Original uncropped images for western blots shown in Figure 1—figure supplement 1 (labelled). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40900148), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for WHIP Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: WHIP
Alternate Names
ATPase WRNIP1, bA420G6.2, EC 3.6.1, FLJ22526, putative helicase RUVBL, Werner helicase interacting protein 1, Werner helicase-interacting protein 1, WHIPRP11-420G6.2
Gene Symbol
WRNIP1
UniProt
Additional WHIP Products
Product Documents for WHIP Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for WHIP Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for WHIP Antibody - BSA Free
Customer Reviews for WHIP Antibody - BSA Free
There are currently no reviews for this product. Be the first to review WHIP Antibody - BSA Free and earn rewards!
Have you used WHIP Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...