ZFR Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86419

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZFR. Peptide sequence: RQIHKVLGMDPLPQMSQRFNIHNNRKRRRDSDGVDGFEAEGKKDKKDYDN The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ZFR Antibody - BSA Free

Western Blot: ZFR Antibody [NBP2-86419]

Western Blot: ZFR Antibody [NBP2-86419]

Western Blot: ZFR Antibody [NBP2-86419] - WB Suggested Anti-ZFR Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: HT1080 cell lysateZFR is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells
Immunohistochemistry-Paraffin: ZFR Antibody [NBP2-86419]

Immunohistochemistry-Paraffin: ZFR Antibody [NBP2-86419]

Immunohistochemistry-Paraffin: ZFR Antibody [NBP2-86419] - Formalin Fixed Paraffin Embedded Tissue: Human Adult heart. Observed Staining: Cytoplasmic. Primary Antibody Concentration: 1:600. Secondary Antibody: Donkey anti-Rabbit-Cy2/3.
Western Blot: ZFR Antibody [NBP2-86419]

Western Blot: ZFR Antibody [NBP2-86419]

Western Blot: ZFR Antibody [NBP2-86419] - Host: Rabbit. Target: ZFR. Positive control (+): HeLa Cell Lysate (HL). Negative control (-): Human Liver (LI). Antibody concentration: 1ug/ml
Immunohistochemistry-Paraffin: ZFR Antibody [NBP2-86419]

Immunohistochemistry-Paraffin: ZFR Antibody [NBP2-86419]

Immunohistochemistry-Paraffin: ZFR Antibody [NBP2-86419] - Paraffin Embedded Tissue: Human bronchiole epithelium. Cellular Data: Epithelial cells of renal tubule. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X
Immunohistochemistry-Paraffin: ZFR Antibody [NBP2-86419]

Immunohistochemistry-Paraffin: ZFR Antibody [NBP2-86419]

Immunohistochemistry-Paraffin: ZFR Antibody [NBP2-86419] - Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue. Observed Staining: Cytoplasmic and nuclear in pinelocytes & intersticial cells. Primary Antibody Concentration: 1:100.

Applications for ZFR Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZFR

ZFR is involved in postimplantation and gastrulation stages of development. Involved in the nucleocytoplasmic shuttling of STAU2. Binds to DNA and RNA

Alternate Names

FLJ41312, hZFR, zinc finger RNA binding protein

Gene Symbol

ZFR

Additional ZFR Products

Product Documents for ZFR Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ZFR Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZFR Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZFR Antibody - BSA Free and earn rewards!

Have you used ZFR Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...