ZNF274 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10523

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ZNF274 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF274 (NP_057408). Peptide sequence SHLIRHQRTHTGERPYACNKCGKAFTQSSHLIGHQRTHNRTKRKKKQPTS

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

62 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ZNF274 Antibody - BSA Free

Immunohistochemistry-Paraffin: ZNF274 Antibody [NBP3-10523]

Immunohistochemistry-Paraffin: ZNF274 Antibody [NBP3-10523]

Immunohistochemistry-Paraffin: ZNF274 Antibody [NBP3-10523] - Immunohistochemical analysis of paraffin-embedded human lung tissue.

Applications for ZNF274 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZNF274

ZNF274 encodes a zinc finger protein containing five C2H2-type zinc finger domains, one or two Kruppel-associated box A (KRAB A) domains, and a leucine-rich domain. The encoded protein has been suggested to be a transcriptional repressor. It localizes predominantly to the nucleolus. Alternatively spliced transcript variants encoding different isoforms exist. These variants utilize alternative polyadenylation signals.

Alternate Names

GIOT2, GIOT-2, gonadotropin inducible transcription repressor-2, Gonadotropin-inducible ovary transcription repressor 2, gonadotropin-inducible transcription repressor 2, KOX7DKFZp434F1811, zinc finger protein 44, zinc finger protein 44 (KOX 7), Zinc finger protein 55DKFZp686L21136, Zinc finger protein 58ZNF504, Zinc finger protein KOX7, zinc finger protein ZnFP12, ZNF, ZNF55, ZNF58

Gene Symbol

ZNF274

Additional ZNF274 Products

Product Documents for ZNF274 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ZNF274 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZNF274 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZNF274 Antibody - BSA Free and earn rewards!

Have you used ZNF274 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies