ZNF276 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-82681
Loading...
Key Product Details
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VKDEFSDLSEGDVLSEDENDKKQNAQSSDESFEPYPERKVSGKKSESKEAKKSEEPRIRKKPGPKPGWKKKLRCEREELPTIY
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (89%)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for ZNF276 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: ZNF276 Antibody [NBP1-82681]
Immunocytochemistry/Immunofluorescence: ZNF276 Antibody [NBP1-82681] - Staining of human cell line A-431 shows positivity in nucleoli, cytoplasm, cell junctions & nucleus but excluded from the nucleoli.Immunohistochemistry-Paraffin: ZNF276 Antibody [NBP1-82681]
Immunohistochemistry-Paraffin: ZNF276 Antibody [NBP1-82681] - Staining of human cerebellum shows nuclear and cytoplasmic positivity in Purkinje and molecular layer cells.Chromatin Immunoprecipitation-exo-Seq: ZNF276 Antibody - BSA Free [NBP1-82681]
ChIP-Exo-Seq composite graph for Anti-ZNF276 (NBP1-82681) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.Immunohistochemistry: ZNF276 Antibody - BSA Free [NBP1-82681] -
ZNF276 activates the Wnt/ beta -catenin signaling by regulation of CYP1B1.A, C Western blotting (A) and RT-qPCR (C) analysis revealed that silencing of CYP1B1 inhibited the expression of c-Myc and Cyclin D1 enhanced by ZNF276 overexpression in MDA-MB-231 cells. B, D Effects of ZNF276 knockdown and CYP1B1 overexpression on c-Myc and Cyclin D1 expression were analyzed in UACC-812 cells by western blotting (B) and RT-qPCR (D). E, F ZNF276 lacking C2H2 domain inhibited the TOP Flash activity enhanced by the intact ZNF276 with wnt3a activation in MDA-MB-231 (E) and UACC-812 (F) cells. G Endogenous beta -catenin expression and distribution was observed by immunofluorescence in MDA-MB-231 cells transfected with intact ZNF276 or ZNF276 lacking C2H2 domain plasmid. Nuc nuclear. Bar = 20 um. *p < 0.05; **p < 0.01; ***p < 0.001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36085146), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunohistochemistry: ZNF276 Antibody - BSA Free [NBP1-82681] -
ZNF276 activates Wnt/ beta -catenin signaling through recruitment of MAGEB2 to regulate CYP1B1 transcription.A GO analysis of the potential ZNF276-interacted proteins. B KEGG analysis of the potential ZNF276-interacted proteins. C, D Both forward (C) and reverse (D) co-IP analysis affirmed the interaction between ZNF276 and MAGEB2. E ChIP-PCR analysis of ZNF276 binding ability at the CYP1B1 promoter affected by MAGEB2 overexpression. F, G The luciferase activity of CYP1B1 promoter decreased by ZNF276 silencing was further enhanced by the expression of MAGEB2 in 293T and MCF-7. H, I RT-qPCR (H) and western blot (I) analysis confirmed the effect of MAGEB2 overexpression in CYP1B1 mRNA and protein expression in MCF-7 cells. J, K The reduced transcriptional activity of CYP1B1 promoter by ZNF276 was partially reversed by MAGEB2. L, M Overexpression of MAGEB2 reversed the decreased cell proliferation, migration and invasion abilities affected by ZNF276 silencing in CCK-8 assay (L), transwell migration (M, up) and transwell invasion (M, down). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36085146), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for ZNF276 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:1000 - 1:2500
Immunohistochemistry-Paraffin
1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: ZNF276
Alternate Names
DNA-binding protein, KIAA1710Zfp46, zinc finger protein 436, ZNF
Gene Symbol
ZNF276
Additional ZNF276 Products
Product Documents for ZNF276 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for ZNF276 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for ZNF276 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review ZNF276 Antibody - BSA Free and earn rewards!
Have you used ZNF276 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...