ZNF276 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82681

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VKDEFSDLSEGDVLSEDENDKKQNAQSSDESFEPYPERKVSGKKSESKEAKKSEEPRIRKKPGPKPGWKKKLRCEREELPTIY

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ZNF276 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ZNF276 Antibody [NBP1-82681]

Immunocytochemistry/ Immunofluorescence: ZNF276 Antibody [NBP1-82681]

Immunocytochemistry/Immunofluorescence: ZNF276 Antibody [NBP1-82681] - Staining of human cell line A-431 shows positivity in nucleoli, cytoplasm, cell junctions & nucleus but excluded from the nucleoli.
Immunohistochemistry-Paraffin: ZNF276 Antibody [NBP1-82681]

Immunohistochemistry-Paraffin: ZNF276 Antibody [NBP1-82681]

Immunohistochemistry-Paraffin: ZNF276 Antibody [NBP1-82681] - Staining of human cerebellum shows nuclear and cytoplasmic positivity in Purkinje and molecular layer cells.
ZNF276 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: ZNF276 Antibody - BSA Free [NBP1-82681]

Chromatin Immunoprecipitation-exo-Seq: ZNF276 Antibody - BSA Free [NBP1-82681]

ChIP-Exo-Seq composite graph for Anti-ZNF276 (NBP1-82681) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.
ZNF276 Antibody - BSA Free

Immunohistochemistry: ZNF276 Antibody - BSA Free [NBP1-82681] -

ZNF276 activates the Wnt/ beta -catenin signaling by regulation of CYP1B1.A, C Western blotting (A) and RT-qPCR (C) analysis revealed that silencing of CYP1B1 inhibited the expression of c-Myc and Cyclin D1 enhanced by ZNF276 overexpression in MDA-MB-231 cells. B, D Effects of ZNF276 knockdown and CYP1B1 overexpression on c-Myc and Cyclin D1 expression were analyzed in UACC-812 cells by western blotting (B) and RT-qPCR (D). E, F ZNF276 lacking C2H2 domain inhibited the TOP Flash activity enhanced by the intact ZNF276 with wnt3a activation in MDA-MB-231 (E) and UACC-812 (F) cells. G Endogenous beta -catenin expression and distribution was observed by immunofluorescence in MDA-MB-231 cells transfected with intact ZNF276 or ZNF276 lacking C2H2 domain plasmid. Nuc nuclear. Bar = 20 um. *p < 0.05; **p < 0.01; ***p < 0.001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36085146), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
ZNF276 Antibody - BSA Free

Immunohistochemistry: ZNF276 Antibody - BSA Free [NBP1-82681] -

ZNF276 activates Wnt/ beta -catenin signaling through recruitment of MAGEB2 to regulate CYP1B1 transcription.A GO analysis of the potential ZNF276-interacted proteins. B KEGG analysis of the potential ZNF276-interacted proteins. C, D Both forward (C) and reverse (D) co-IP analysis affirmed the interaction between ZNF276 and MAGEB2. E ChIP-PCR analysis of ZNF276 binding ability at the CYP1B1 promoter affected by MAGEB2 overexpression. F, G The luciferase activity of CYP1B1 promoter decreased by ZNF276 silencing was further enhanced by the expression of MAGEB2 in 293T and MCF-7. H, I RT-qPCR (H) and western blot (I) analysis confirmed the effect of MAGEB2 overexpression in CYP1B1 mRNA and protein expression in MCF-7 cells. J, K The reduced transcriptional activity of CYP1B1 promoter by ZNF276 was partially reversed by MAGEB2. L, M Overexpression of MAGEB2 reversed the decreased cell proliferation, migration and invasion abilities affected by ZNF276 silencing in CCK-8 assay (L), transwell migration (M, up) and transwell invasion (M, down). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36085146), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for ZNF276 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZNF276

ZNF276 may be involved in transcriptional regulation

Alternate Names

DNA-binding protein, KIAA1710Zfp46, zinc finger protein 436, ZNF

Gene Symbol

ZNF276

Additional ZNF276 Products

Product Documents for ZNF276 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ZNF276 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZNF276 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZNF276 Antibody - BSA Free and earn rewards!

Have you used ZNF276 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...