ZNF384 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-94454

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all ZNF384 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human ZNF384 (NP_001129206.1). MEESHFNSNPYFWPSIPTVSGQIENTMFINKMKDQLLPEKGCGLAPPHYPTLLTVPASVSLPSGISMDTESKSDQLTPHS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ZNF384 Antibody - Azide and BSA Free

Western Blot: ZNF384 AntibodyAzide and BSA Free [NBP2-94454]

Western Blot: ZNF384 AntibodyAzide and BSA Free [NBP2-94454]

Western Blot: ZNF384 Antibody [NBP2-94454] - Western blot analysis of extracts of HeLa cells, using ZNF384 antibody (NBP2-94454) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunohistochemistry-Paraffin: ZNF384 Antibody - Azide and BSA Free [NBP2-94454]

Immunohistochemistry-Paraffin: ZNF384 Antibody - Azide and BSA Free [NBP2-94454]

Immunohistochemistry-Paraffin: ZNF384 Antibody [NBP2-94454] - Immunohistochemistry of paraffin-embedded rat testis using ZNF384 Rabbit pAb (NBP2-94454) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Western Blot: ZNF384 AntibodyAzide and BSA Free [NBP2-94454]

Western Blot: ZNF384 AntibodyAzide and BSA Free [NBP2-94454]

Western Blot: ZNF384 Antibody [NBP2-94454] - Western blot analysis of extracts of Rat thymus, using ZNF384 antibody (NBP2-94454) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Immunohistochemistry-Paraffin: ZNF384 Antibody - Azide and BSA Free [NBP2-94454]

Immunohistochemistry-Paraffin: ZNF384 Antibody - Azide and BSA Free [NBP2-94454]

Immunohistochemistry-Paraffin: ZNF384 Antibody [NBP2-94454] - Immunohistochemistry of paraffin-embedded human tonsil using ZNF384 Rabbit pAb (NBP2-94454) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: ZNF384 Antibody - Azide and BSA Free [NBP2-94454]

Immunohistochemistry-Paraffin: ZNF384 Antibody - Azide and BSA Free [NBP2-94454]

Immunohistochemistry-Paraffin: ZNF384 Antibody [NBP2-94454] - Immunohistochemistry of paraffin-embedded mouse lung using ZNF384 Rabbit pAb (NBP2-94454) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Applications for ZNF384 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ZNF384

The ZNF384 gene contains long CAG trinucleotide repeats coding consecutive glutamine residues. The gene product may functionsas a transcription factor, with a potential role in the regulation of neurodevelopment or neuroplasticity. The proteinappears to bind an

Alternate Names

CAG repeat protein 1, CAG/CTG 2, Cas-interacting zinc finger protein, zinc finger protein 384

Gene Symbol

ZNF384

Additional ZNF384 Products

Product Documents for ZNF384 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ZNF384 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZNF384 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review ZNF384 Antibody - Azide and BSA Free and earn rewards!

Have you used ZNF384 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies