ZZEF1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83828

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (95%), Rat (95%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ZZEF1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: DYFFLEVQKRFDGDELTTDERIRSLAQRWQPSKSLRLEEQSAKAVDTDMIILPCLSRPARCDQATAESNPVTQKLI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ZZEF1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ZZEF1 Antibody [NBP1-83828]

Immunocytochemistry/ Immunofluorescence: ZZEF1 Antibody [NBP1-83828]

Immunocytochemistry/Immunofluorescence: ZZEF1 Antibody [NBP1-83828] - Staining of human cell line A-431 shows localization to nucleoplasm & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ZZEF1 Antibody [NBP1-83828]

Immunohistochemistry-Paraffin: ZZEF1 Antibody [NBP1-83828]

Immunohistochemistry-Paraffin: ZZEF1 Antibody [NBP1-83828] - Staining of human pancreas shows no positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: ZZEF1 Antibody [NBP1-83828]

Immunohistochemistry-Paraffin: ZZEF1 Antibody [NBP1-83828]

Immunohistochemistry-Paraffin: ZZEF1 Antibody [NBP1-83828] - Staining of human testis shows strong nuclear and cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: ZZEF1 Antibody [NBP1-83828]

Immunohistochemistry-Paraffin: ZZEF1 Antibody [NBP1-83828]

Immunohistochemistry-Paraffin: ZZEF1 Antibody [NBP1-83828] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ZZEF1 Antibody [NBP1-83828]

Immunohistochemistry-Paraffin: ZZEF1 Antibody [NBP1-83828]

Immunohistochemistry-Paraffin: ZZEF1 Antibody [NBP1-83828] - Staining of human skeletal muscle shows no positivity in myocytes.

Applications for ZZEF1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZZEF1

Chimera RNA interference (chimera RNAi) is process by which small interfering RNA/DNA chimera triggers the destruction of mRNA for the original gene. The discovery work, design, and application of chimera RNAi has been pioneered by Professor Kaoru Saigo and Dr. Kumiko Ui-Tei at the University of Tokyo. Chimera RNAi has many advantages over the conventional siRNAs. First, it has been demonstrated to have reliable knock-down for over 10,000 human genes. Because the human genome is composed of an intricate, genetic network, chimera RNAi's unique design has successfully obviated the off-target effects including microRNA-based influence. Another advantage of the chimera RNAi technology is its effectiveness at low concentrations (0.5nM to 5nM); only mRNA is destroyed so genomic genes are not affected. Finally, having both the sense and anti-sense strands consisting RNA/DNA chimera, it offers much greater compound stability for streamlining in vitro and in vivo assays and applications while minimizing interferon induction and other adverse reactions.

Alternate Names

FLJ10821, FLJ23789, KIAA0399, MGC166929, zinc finger, ZZ-type with EF hand domain 1, zinc finger, ZZ-type with EF-hand domain 1, ZZZ4

Gene Symbol

ZZEF1

Additional ZZEF1 Products

Product Documents for ZZEF1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ZZEF1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZZEF1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZZEF1 Antibody - BSA Free and earn rewards!

Have you used ZZEF1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies