15-PGDH/HPGD Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87061

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGI

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (81%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for 15-PGDH/HPGD Antibody - BSA Free

Immunohistochemistry-Paraffin: 15-PGDH/HPGD Antibody [NBP1-87061]

Immunohistochemistry-Paraffin: 15-PGDH/HPGD Antibody [NBP1-87061]

Immunohistochemistry-Paraffin: 15-PGDH/HPGD Antibody [NBP1-87061] - Analysis in human urinary bladder and skeletal muscle tissues. Corresponding HPGD RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: 15-PGDH/HPGD Antibody [NBP1-87061]

Immunohistochemistry-Paraffin: 15-PGDH/HPGD Antibody [NBP1-87061]

Immunohistochemistry-Paraffin: 15-PGDH/HPGD Antibody [NBP1-87061] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.
Immunohistochemistry-Paraffin: 15-PGDH/HPGD Antibody [NBP1-87061]

Immunohistochemistry-Paraffin: 15-PGDH/HPGD Antibody [NBP1-87061]

Immunohistochemistry-Paraffin: 15-PGDH/HPGD Antibody [NBP1-87061] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: 15-PGDH/HPGD Antibody [NBP1-87061]

Immunohistochemistry-Paraffin: 15-PGDH/HPGD Antibody [NBP1-87061]

Immunohistochemistry-Paraffin: 15-PGDH/HPGD Antibody [NBP1-87061] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: 15-PGDH/HPGD Antibody [NBP1-87061]

Immunohistochemistry-Paraffin: 15-PGDH/HPGD Antibody [NBP1-87061]

Immunohistochemistry-Paraffin: 15-PGDH/HPGD Antibody [NBP1-87061] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
15-PGDH/HPGD Antibody - BSA Free Western Blot: 15-PGDH/HPGD Antibody - BSA Free [NBP1-87061]

Western Blot: 15-PGDH/HPGD Antibody - BSA Free [NBP1-87061]

Analysis using Anti-HPGD antibody NBP1-87061 (A) shows similar pattern to independent antibody NBP1-87062 (B).
15-PGDH/HPGD Antibody - BSA Free Western Blot: 15-PGDH/HPGD Antibody - BSA Free [NBP1-87061]

Western Blot: 15-PGDH/HPGD Antibody - BSA Free [NBP1-87061]

Analysis in human cell lines A-549 and A-431 using Anti-HPGD antibody. Corresponding HPGD RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
15-PGDH/HPGD Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: 15-PGDH/HPGD Antibody [NBP1-87061]

Immunocytochemistry/ Immunofluorescence: 15-PGDH/HPGD Antibody [NBP1-87061]

Staining of human cell line U-2 OS shows localization to cytosol.

Applications for 15-PGDH/HPGD Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: 15-PGDH/HPGD

15-PGDH (15-hydroxyprostaglandin dehydrogenase (NAD+)) is responsible for prostaglandin inactivation and supports the regulation of functions that are controled by prostaglandin levels. Specifically, 15PGDH catalyzes the chemical reaction to convert NAD+ to NADH and H+.

15-PGDH is a novel tumor suppressor in the COX-2 pathway. 15-PGDH is found in many normal tissues and appears to be down-regulated in colorectal and lung carcinoma tissue.

Long Name

15-Hydroxyprostaglandin Dehydrogenase

Alternate Names

15PGDH, HPGD, PGDH1, SDR36C1

Gene Symbol

HPGD

Additional 15-PGDH/HPGD Products

Product Documents for 15-PGDH/HPGD Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for 15-PGDH/HPGD Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for 15-PGDH/HPGD Antibody - BSA Free

There are currently no reviews for this product. Be the first to review 15-PGDH/HPGD Antibody - BSA Free and earn rewards!

Have you used 15-PGDH/HPGD Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...