C-Reactive Protein/CRP Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87183

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSPNVLNW

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24743550)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for C-Reactive Protein/CRP Antibody - BSA Free

Western Blot: C-Reactive Protein/CRP Antibody [NBP1-87183]

Western Blot: C-Reactive Protein/CRP Antibody [NBP1-87183]

Western Blot: C-Reactive Protein/CRP Antibody [NBP1-87183] - Analysis using Anti-CRP antibody NBP1-87183 (A) shows similar pattern to independent antibody NBP1-87184 (B).
Immunohistochemistry-Paraffin: C-Reactive Protein/CRP Antibody [NBP1-87183]

Immunohistochemistry-Paraffin: C-Reactive Protein/CRP Antibody [NBP1-87183]

Immunohistochemistry-Paraffin: C-Reactive Protein/CRP Antibody [NBP1-87183] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Applications for C-Reactive Protein/CRP Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: C-Reactive Protein/CRP

C Reactive Protein is a major acute phase reactant synthesized primarily in the liver hepatocytes. It is a pentraxin (cyclic pentameric protein) compound of five identical nonglycosylated subunits of 206 amino acids each (m.w. 24 kDa), that are bound noncovalently to form the physiologic CRP molecule (m.w. 117.5 kDa). C Reactive Protein mediates activities associated with preimmune nonspecific host resistance. It is opsonic, an initiator of the classical complement cascade and an activator of monocytes/macrophages. CRP also binds to several nuclear components including chromatin, histones and snRNP, suggesting that it may play a role as a scavenger during cell necrosis. Studies have revealed that among other markers of inflammation, CRP shows the strongest association with cardiovascular events. Many clinical studies demonstrated that coronary mortality among patients with unstable angina and elevated CRP is significantly higher comparing with the patients without elevated CRP. Measurements of C reactive protein (hsCRP) in the patients with ischemic heart disease provide a novel method for detecting individuals at high risk of plaque rupture.

Alternate Names

CRP

Gene Symbol

CRP

Additional C-Reactive Protein/CRP Products

Product Documents for C-Reactive Protein/CRP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for C-Reactive Protein/CRP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for C-Reactive Protein/CRP Antibody - BSA Free

Customer Reviews for C-Reactive Protein/CRP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review C-Reactive Protein/CRP Antibody - BSA Free and earn rewards!

Have you used C-Reactive Protein/CRP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for C-Reactive Protein/CRP Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: We are looking to purchase some antibodies against c-reactive protein (preferably antibody clones c6 and c2). For our purpose, we are looking for antibodies that are preferably optimized for, or at least have reported use with, human serum samples, because we are wary of the serum matrix effect on the functioning of the antibody. Do you have any recommendations for these requirements?

    A:

    For human c-reactive protein, we currently sell 18 antibodies which recognise the human protein. Of these, NB110-55637 shows a Western blot image using a human serum sample, while NBP1-87183 and NBP1-87184 have Western blot images generated using human plasma. Clone C2 has catalogue number NB100-73033 and clone C6 has catalogue number NB200-442.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...