Carboxypeptidase B1/CPB1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38549

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: HGGEHFEGEKVFRVNVEDENHINIIRELASTTQIDFWKPDSVTQIKPHSTVDFRVKAEDTVTVENVLK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Carboxypeptidase B1/CPB1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Carboxypeptidase B1/CPB1 Antibody [NBP2-38549]

Immunohistochemistry-Paraffin: Carboxypeptidase B1/CPB1 Antibody [NBP2-38549]

Immunohistochemistry-Paraffin: Carboxypeptidase B1/CPB1 Antibody [NBP2-38549] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: Carboxypeptidase B1/CPB1 Antibody [NBP2-38549]

Immunohistochemistry-Paraffin: Carboxypeptidase B1/CPB1 Antibody [NBP2-38549]

Immunohistochemistry-Paraffin: Carboxypeptidase B1/CPB1 Antibody [NBP2-38549] - Staining of human pancreas shows high expression.
Immunohistochemistry-Paraffin: Carboxypeptidase B1/CPB1 Antibody [NBP2-38549]

Immunohistochemistry-Paraffin: Carboxypeptidase B1/CPB1 Antibody [NBP2-38549]

Immunohistochemistry-Paraffin: Carboxypeptidase B1/CPB1 Antibody [NBP2-38549] - Staining in human pancreas and skeletal muscle tissues using anti-CPB1 antibody. Corresponding CPB1 RNA-seq data are presented for the same tissues.

Applications for Carboxypeptidase B1/CPB1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Carboxypeptidase B1/CPB1

Carboxypeptidase catalyzes the hydrolysis of the basic amino acids lysine, arginine and ornithine from the C-terminal position in polypeptides. It occurs as a zymogen in the pancreas in most vertebrates. This reagent is suited to enable an immunological appraoch to the study of protein and peptide structure.

Alternate Names

CPB1, PASP, PCPB

Gene Symbol

CPB1

UniProt

Additional Carboxypeptidase B1/CPB1 Products

Product Documents for Carboxypeptidase B1/CPB1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Carboxypeptidase B1/CPB1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Carboxypeptidase B1/CPB1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Carboxypeptidase B1/CPB1 Antibody - BSA Free and earn rewards!

Have you used Carboxypeptidase B1/CPB1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Carboxypeptidase B1/CPB1 Antibody - BSA Free

Showing  1 - 22 FAQs Showing All
  • Q: I am trying to establish ELISA detection for carboxy peptidase. I am using a rat recombinant carboxypeptodase b from Roche diagnostics (cat no.03358682103). Can you please suggest the suitable kit.

    A:

    Here is a link to our CPB1 products. H00001360-AP21 and H00001360-AP11 may suit your needs.

  • Q: I use porcine carboxypeptidase B (CPB) in my fermentation process. I want to detect the residual CPB in my finished product preferably by ELISA/western blot. How will antibody pairs from Novus Biologics help me do that? Is a colorimetric assay possible with the antibody pair?

    A: Any detection system can be employed when using the antibody pairs. The detection system will depend on the secondary used against the detection primary antibody from the pair, and the conjugate on the secondary antibody. The pair will work effectively in capturing the protein of interest, and subsequently detecting it with the second antibody in the pair for ELISA. This pair is not evaluated in Western Blot directly, but there Novus carries similar primary antibodies that we have that are validated in that application.

  • Q: I am trying to establish ELISA detection for carboxy peptidase. I am using a rat recombinant carboxypeptodase b from Roche diagnostics (cat no.03358682103). Can you please suggest the suitable kit.

    A:

    Here is a link to our CPB1 products. H00001360-AP21 and H00001360-AP11 may suit your needs.

  • Q: I use porcine carboxypeptidase B (CPB) in my fermentation process. I want to detect the residual CPB in my finished product preferably by ELISA/western blot. How will antibody pairs from Novus Biologics help me do that? Is a colorimetric assay possible with the antibody pair?

    A: Any detection system can be employed when using the antibody pairs. The detection system will depend on the secondary used against the detection primary antibody from the pair, and the conjugate on the secondary antibody. The pair will work effectively in capturing the protein of interest, and subsequently detecting it with the second antibody in the pair for ELISA. This pair is not evaluated in Western Blot directly, but there Novus carries similar primary antibodies that we have that are validated in that application.

Showing  1 - 22 FAQs Showing All
View all FAQs for Antibodies
Loading...