CD11b Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-92978

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 145-340 of CD11b (NP_000623.2). PQEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFNITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQVNNFEALKTIQNQLREKIFAIEGTQT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

127 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CD11b Antibody - BSA Free

Western Blot: CD11b AntibodyAzide and BSA Free [NBP2-92978]

Western Blot: CD11b AntibodyAzide and BSA Free [NBP2-92978]

Western Blot: CD11b Antibody [NBP2-92978] - Analysis of extracts of various cell lines, using CD11b antibody (NBP2-92978) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 90s.
Immunohistochemistry-Paraffin: CD11b Antibody - Azide and BSA Free [NBP2-92978]

Immunohistochemistry-Paraffin: CD11b Antibody - Azide and BSA Free [NBP2-92978]

Immunohistochemistry-Paraffin: CD11b Antibody [NBP2-92978] - Mouse spleen using CD11b antibody (NBP2-92978) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: CD11b Antibody - Azide and BSA Free [NBP2-92978]

Immunohistochemistry-Paraffin: CD11b Antibody - Azide and BSA Free [NBP2-92978]

Immunohistochemistry-Paraffin: CD11b Antibody [NBP2-92978] - Human tonsil using CD11b antibody (NBP2-92978) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunocytochemistry/ Immunofluorescence: CD11b Antibody - Azide and BSA Free [NBP2-92978]

Immunocytochemistry/ Immunofluorescence: CD11b Antibody - Azide and BSA Free [NBP2-92978]

Immunocytochemistry/Immunofluorescence: CD11b Antibody [NBP2-92978] - Immunofluorescence analysis of TF-1 cells using CD11b Rabbit pAb (NBP2-92978) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
CD11b Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: CD11b Antibody - Azide and BSA Free [NBP2-92978] -

Immunocytochemistry/ Immunofluorescence: CD11b Antibody - Azide and BSA Free [NBP2-92978] - Immunofluorescence analysis of TF-1 cells using CD11b Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
CD11b Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: CD11b Antibody - Azide and BSA Free [NBP2-92978] -

Immunocytochemistry/ Immunofluorescence: CD11b Antibody - Azide and BSA Free [NBP2-92978] - Immunofluorescence analysis of THP-1 cells using CD11b Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
CD11b Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: CD11b Antibody - Azide and BSA Free [NBP2-92978] -

Immunocytochemistry/ Immunofluorescence: CD11b Antibody - Azide and BSA Free [NBP2-92978] - Immunofluorescence analysis of THP-1 cells using CD11b Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
CD11b Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: CD11b Antibody - Azide and BSA Free [NBP2-92978] -

Immunocytochemistry/ Immunofluorescence: CD11b Antibody - Azide and BSA Free [NBP2-92978] - Immunofluorescence analysis of THP-1 cells using CD11b Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
CD11b Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: CD11b Antibody - Azide and BSA Free [NBP2-92978] -

Immunocytochemistry/ Immunofluorescence: CD11b Antibody - Azide and BSA Free [NBP2-92978] - Immunofluorescence analysis of TF-1 cells using CD11b Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for CD11b Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL

Immunocytochemistry/ Immunofluorescence

1:50 -1:200

Immunohistochemistry

1:50-1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:100 - 1:500

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CD11b/Integrin alpha M

CD11b (integrin alpha M subunit) is a type I transmembrane glycoprotein. CD11b combines with the Integrin beta 2 subunit (CD18) to form the non-covalent heterodimer Integrin alpha M/beta 2, also known as Mac-1 and complement receptor type 3 (CR3). The CD11b/CD18 (Mac-1) heterodimer has a theoretical molecular weight of 127kDa but is often observed near 170kDa due to post translational modifications. Integrins are transmembrane proteins that mediate interactions between adhesion molecules on adjacent cells and/or the extracellular matrix. Integrins have diverse roles in several biological processes, including cell migration during development, wound healing, cell differentiation, and apoptosis. The particular integrin CD11b is known as a pro-inflammatory molecule given its ability to promote phagocyte cytotoxic functions while enhancing several effector molecules such as FcGR, uPAR, and CD14 (1). In macrophages, CpG-DNA stimulates lysosomal degradation and vacuolar acidification, subsequently promoting CD11b release via TLR9 (2). During an acute infection, high CD11b/Mac-1 expression on antigen-specific CD8 (+) T cells can signify recent activation of the immune system, whereas naive T cells and virus-specific memory CD8 (+) T cells express little or no Mac-1 when exposed to a virus (3). Variations at the ITGAM gene, which encodes for the CD11b chain of the Mac-1 integrin, is one of the main genetic risk factors involved in systemic lupus erythematosus /SLE disorder (4).

References

1. Rosetti, F., & Mayadas, T. N. (2016). The many faces of Mac-1 in autoimmune disease. Immunol Rev, 269(1), 175-193. doi:10.1111/imr.12373

2. Kim, D., Kim, T. H., Wu, G., Park, B. K., Ha, J. H., Kim, Y. S.,... Kwon, H. J. (2016). Extracellular Release of CD11b by TLR9 Stimulation in Macrophages. PLoS One, 11(3), e0150677. doi:10.1371/journal.pone.0150677

3. Christensen, J. E., Andreasen, S. O., Christensen, J. P., & Thomsen, A. R. (2001). CD11b expression as a marker to distinguish between recently activated effector CD8(+) T cells and memory cells. Int Immunol, 13(4), 593-600. doi:10.1093/intimm/13.4.593

4. Nath, S. K., Han, S., Kim-Howard, X., Kelly, J. A., Viswanathan, P., Gilkeson, G. S.,... Harley, J. B. (2008). A nonsynonymous functional variant in integrin-alpha(M) (encoded by ITGAM) is associated with systemic lupus erythematosus. Nat Genet, 40(2), 152-154. doi:10.1038/ng.71

Alternate Names

CD11b, Integrin alpha M, ITGAM

Gene Symbol

ITGAM

Additional CD11b/Integrin alpha M Products

Product Documents for CD11b Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CD11b Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CD11b Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CD11b Antibody - BSA Free and earn rewards!

Have you used CD11b Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CD11b Antibody - BSA Free

Showing  1 - 58 FAQs Showing All
  • Q: Do you know if this CD11b antibody can be used in CD11b positive cell depletion? 

    A: This particular CD11b antibody is not reccomended for depletion studies due to the preservative used; however, our CD11b antibody NBP1-06650 is offered in a preservative free format and has been validated for blocking.

  • Q: I am looking for a Mac-1 (microglia cell marker) antibody to do immunostaining with my mouse brain and I checked, you have a lot of antibodies for this biomarker. I don't know which one is the best to be used for immunohistology on mouse brain tissue. Could you please help with this?

    A: I would recommend NB110-89474. This antibody has been published in 11 scientific articles, including several times in IHC in mouse. As long as CD11b is expressed in your sample, it should work just fine and is backed by our 100% Novus Guarantee.

  • Q: I'm not sure if this will work for me, can I get a free sample of your CD11b antibody to test?

    A: We don't offer free samples but we do offer this CD11b antibody in a trial size of 0.025 ml at a reduced cost, all antibodies are backed by our 100% guarantee to work in all validated species and applications on the product's web page.

  • Q: Is CD11b antibody also staining neutrophils in the brain

    A: CD11b is typically used as a marker for granulocytes and macrophages. You may need a combination of markers to specifically identify neutrophils

  • Q: Looking for a bone marrow macrophage marker can you recommend a CD11b antibody for ICC?

    A: I would recommend NB110-89474 which is our most popular CD11b antibody and has been validated in ICC and cited in 18 publications.

  • Q: The protocol says to do enzymatic antigen retrieval before incubating with the CD11b antibody, which enzyme is used?

    A: The protocol is referencting the PIER method using Proteinase K as the enzyme.

  • Q: We need a CD11b antibody for IHC-P on mouse tissue conjugated to FITC, do you have one that will work?

    A: We have 3 CD11b antibodies for IHC-P and just one CD11 b antibody we offer conjugated to FITC, NB110-89474F.

  • Q: What types of cells can this CD11b antibody be used as a marker for?

    A: A study used this CD11b antibody to stain granulocytes in mouse uterine tissue in IHC. CD11b is also expressed on other leukocytes such as monocytes, macrophages, and natural killer cells.

  • Q: Do you know if this CD11b antibody can be used in CD11b positive cell depletion? 

    A: This particular CD11b antibody is not reccomended for depletion studies due to the preservative used; however, our CD11b antibody NBP1-06650 is offered in a preservative free format and has been validated for blocking.

  • Q: I am looking for a Mac-1 (microglia cell marker) antibody to do immunostaining with my mouse brain and I checked, you have a lot of antibodies for this biomarker. I don't know which one is the best to be used for immunohistology on mouse brain tissue. Could you please help with this?

    A: I would recommend NB110-89474. This antibody has been published in 11 scientific articles, including several times in IHC in mouse. As long as CD11b is expressed in your sample, it should work just fine and is backed by our 100% Novus Guarantee.

  • Q: I'm not sure if this will work for me, can I get a free sample of your CD11b antibody to test?

    A: We don't offer free samples but we do offer this CD11b antibody in a trial size of 0.025 ml at a reduced cost, all antibodies are backed by our 100% guarantee to work in all validated species and applications on the product's web page.

  • Q: Is CD11b antibody also staining neutrophils in the brain

    A: CD11b is typically used as a marker for granulocytes and macrophages. You may need a combination of markers to specifically identify neutrophils

  • Q: Looking for a bone marrow macrophage marker can you recommend a CD11b antibody for ICC?

    A: I would recommend NB110-89474 which is our most popular CD11b antibody and has been validated in ICC and cited in 18 publications.

  • Q: The protocol says to do enzymatic antigen retrieval before incubating with the CD11b antibody, which enzyme is used?

    A: The protocol is referencting the PIER method using Proteinase K as the enzyme.

  • Q: We need a CD11b antibody for IHC-P on mouse tissue conjugated to FITC, do you have one that will work?

    A: We have 3 CD11b antibodies for IHC-P and just one CD11 b antibody we offer conjugated to FITC, NB110-89474F.

  • Q: What types of cells can this CD11b antibody be used as a marker for?

    A: A study used this CD11b antibody to stain granulocytes in mouse uterine tissue in IHC. CD11b is also expressed on other leukocytes such as monocytes, macrophages, and natural killer cells.

  • Q: Do you know if this CD11b antibody can be used in CD11b positive cell depletion? 

    A: This particular CD11b antibody is not reccomended for depletion studies due to the preservative used; however, our CD11b antibody NBP1-06650 is offered in a preservative free format and has been validated for blocking.

  • Q: I am looking for a Mac-1 (microglia cell marker) antibody to do immunostaining with my mouse brain and I checked, you have a lot of antibodies for this biomarker. I don't know which one is the best to be used for immunohistology on mouse brain tissue. Could you please help with this?

    A: I would recommend NB110-89474. This antibody has been published in 11 scientific articles, including several times in IHC in mouse. As long as CD11b is expressed in your sample, it should work just fine and is backed by our 100% Novus Guarantee.

  • Q: I'm not sure if this will work for me, can I get a free sample of your CD11b antibody to test?

    A: We don't offer free samples but we do offer this CD11b antibody in a trial size of 0.025 ml at a reduced cost, all antibodies are backed by our 100% guarantee to work in all validated species and applications on the product's web page.

  • Q: Is CD11b antibody also staining neutrophils in the brain

    A: CD11b is typically used as a marker for granulocytes and macrophages. You may need a combination of markers to specifically identify neutrophils

  • Q: Looking for a bone marrow macrophage marker can you recommend a CD11b antibody for ICC?

    A: I would recommend NB110-89474 which is our most popular CD11b antibody and has been validated in ICC and cited in 18 publications.

  • Q: The protocol says to do enzymatic antigen retrieval before incubating with the CD11b antibody, which enzyme is used?

    A: The protocol is referencting the PIER method using Proteinase K as the enzyme.

  • Q: We need a CD11b antibody for IHC-P on mouse tissue conjugated to FITC, do you have one that will work?

    A: We have 3 CD11b antibodies for IHC-P and just one CD11 b antibody we offer conjugated to FITC, NB110-89474F.

  • Q: What types of cells can this CD11b antibody be used as a marker for?

    A: A study used this CD11b antibody to stain granulocytes in mouse uterine tissue in IHC. CD11b is also expressed on other leukocytes such as monocytes, macrophages, and natural killer cells.

  • Q: Do you know if this CD11b antibody can be used in CD11b positive cell depletion? 

    A: This particular CD11b antibody is not reccomended for depletion studies due to the preservative used; however, our CD11b antibody NBP1-06650 is offered in a preservative free format and has been validated for blocking.

  • Q: I am looking for a Mac-1 (microglia cell marker) antibody to do immunostaining with my mouse brain and I checked, you have a lot of antibodies for this biomarker. I don't know which one is the best to be used for immunohistology on mouse brain tissue. Could you please help with this?

    A: I would recommend NB110-89474. This antibody has been published in 11 scientific articles, including several times in IHC in mouse. As long as CD11b is expressed in your sample, it should work just fine and is backed by our 100% Novus Guarantee.

  • Q: I'm not sure if this will work for me, can I get a free sample of your CD11b antibody to test?

    A: We don't offer free samples but we do offer this CD11b antibody in a trial size of 0.025 ml at a reduced cost, all antibodies are backed by our 100% guarantee to work in all validated species and applications on the product's web page.

  • Q: Is CD11b antibody also staining neutrophils in the brain

    A: CD11b is typically used as a marker for granulocytes and macrophages. You may need a combination of markers to specifically identify neutrophils

  • Q: Looking for a bone marrow macrophage marker can you recommend a CD11b antibody for ICC?

    A: I would recommend NB110-89474 which is our most popular CD11b antibody and has been validated in ICC and cited in 18 publications.

  • Q: The protocol says to do enzymatic antigen retrieval before incubating with the CD11b antibody, which enzyme is used?

    A: The protocol is referencting the PIER method using Proteinase K as the enzyme.

  • Q: We need a CD11b antibody for IHC-P on mouse tissue conjugated to FITC, do you have one that will work?

    A: We have 3 CD11b antibodies for IHC-P and just one CD11 b antibody we offer conjugated to FITC, NB110-89474F.

  • Q: What types of cells can this CD11b antibody be used as a marker for?

    A: A study used this CD11b antibody to stain granulocytes in mouse uterine tissue in IHC. CD11b is also expressed on other leukocytes such as monocytes, macrophages, and natural killer cells.

  • Q: Do you know if this CD11b antibody can be used in CD11b positive cell depletion? 

    A: This particular CD11b antibody is not reccomended for depletion studies due to the preservative used; however, our CD11b antibody NBP1-06650 is offered in a preservative free format and has been validated for blocking.

  • Q: I am looking for a Mac-1 (microglia cell marker) antibody to do immunostaining with my mouse brain and I checked, you have a lot of antibodies for this biomarker. I don't know which one is the best to be used for immunohistology on mouse brain tissue. Could you please help with this?

    A: I would recommend NB110-89474. This antibody has been published in 11 scientific articles, including several times in IHC in mouse. As long as CD11b is expressed in your sample, it should work just fine and is backed by our 100% Novus Guarantee.

  • Q: I'm not sure if this will work for me, can I get a free sample of your CD11b antibody to test?

    A: We don't offer free samples but we do offer this CD11b antibody in a trial size of 0.025 ml at a reduced cost, all antibodies are backed by our 100% guarantee to work in all validated species and applications on the product's web page.

  • Q: Is CD11b antibody also staining neutrophils in the brain

    A: CD11b is typically used as a marker for granulocytes and macrophages. You may need a combination of markers to specifically identify neutrophils

  • Q: Looking for a bone marrow macrophage marker can you recommend a CD11b antibody for ICC?

    A: I would recommend NB110-89474 which is our most popular CD11b antibody and has been validated in ICC and cited in 18 publications.

  • Q: The protocol says to do enzymatic antigen retrieval before incubating with the CD11b antibody, which enzyme is used?

    A: The protocol is referencting the PIER method using Proteinase K as the enzyme.

  • Q: We need a CD11b antibody for IHC-P on mouse tissue conjugated to FITC, do you have one that will work?

    A: We have 3 CD11b antibodies for IHC-P and just one CD11 b antibody we offer conjugated to FITC, NB110-89474F.

  • Q: What types of cells can this CD11b antibody be used as a marker for?

    A: A study used this CD11b antibody to stain granulocytes in mouse uterine tissue in IHC. CD11b is also expressed on other leukocytes such as monocytes, macrophages, and natural killer cells.

  • Q: Do you know if this CD11b antibody can be used in CD11b positive cell depletion? 

    A: This particular CD11b antibody is not reccomended for depletion studies due to the preservative used; however, our CD11b antibody NBP1-06650 is offered in a preservative free format and has been validated for blocking.

  • Q: I am looking for a Mac-1 (microglia cell marker) antibody to do immunostaining with my mouse brain and I checked, you have a lot of antibodies for this biomarker. I don't know which one is the best to be used for immunohistology on mouse brain tissue. Could you please help with this?

    A: I would recommend NB110-89474. This antibody has been published in 11 scientific articles, including several times in IHC in mouse. As long as CD11b is expressed in your sample, it should work just fine and is backed by our 100% Novus Guarantee.

  • Q: I'm not sure if this will work for me, can I get a free sample of your CD11b antibody to test?

    A: We don't offer free samples but we do offer this CD11b antibody in a trial size of 0.025 ml at a reduced cost, all antibodies are backed by our 100% guarantee to work in all validated species and applications on the product's web page.

  • Q: Is CD11b antibody also staining neutrophils in the brain

    A: CD11b is typically used as a marker for granulocytes and macrophages. You may need a combination of markers to specifically identify neutrophils

  • Q: Looking for a bone marrow macrophage marker can you recommend a CD11b antibody for ICC?

    A: I would recommend NB110-89474 which is our most popular CD11b antibody and has been validated in ICC and cited in 18 publications.

  • Q: The protocol says to do enzymatic antigen retrieval before incubating with the CD11b antibody, which enzyme is used?

    A: The protocol is referencting the PIER method using Proteinase K as the enzyme.

  • Q: We need a CD11b antibody for IHC-P on mouse tissue conjugated to FITC, do you have one that will work?

    A: We have 3 CD11b antibodies for IHC-P and just one CD11 b antibody we offer conjugated to FITC, NB110-89474F.

  • Q: What types of cells can this CD11b antibody be used as a marker for?

    A: A study used this CD11b antibody to stain granulocytes in mouse uterine tissue in IHC. CD11b is also expressed on other leukocytes such as monocytes, macrophages, and natural killer cells.

  • Q: Do you know if this CD11b antibody can be used in CD11b positive cell depletion? 

    A: This particular CD11b antibody is not reccomended for depletion studies due to the preservative used; however, our CD11b antibody NBP1-06650 is offered in a preservative free format and has been validated for blocking.

  • Q: I am looking for a Mac-1 (microglia cell marker) antibody to do immunostaining with my mouse brain and I checked, you have a lot of antibodies for this biomarker. I don't know which one is the best to be used for immunohistology on mouse brain tissue. Could you please help with this?

    A: I would recommend NB110-89474. This antibody has been published in 11 scientific articles, including several times in IHC in mouse. As long as CD11b is expressed in your sample, it should work just fine and is backed by our 100% Novus Guarantee.

  • Q: I'm not sure if this will work for me, can I get a free sample of your CD11b antibody to test?

    A: We don't offer free samples but we do offer this CD11b antibody in a trial size of 0.025 ml at a reduced cost, all antibodies are backed by our 100% guarantee to work in all validated species and applications on the product's web page.

  • Q: Is CD11b antibody also staining neutrophils in the brain

    A: CD11b is typically used as a marker for granulocytes and macrophages. You may need a combination of markers to specifically identify neutrophils

  • Q: Looking for a bone marrow macrophage marker can you recommend a CD11b antibody for ICC?

    A: I would recommend NB110-89474 which is our most popular CD11b antibody and has been validated in ICC and cited in 18 publications.

  • Q: The protocol says to do enzymatic antigen retrieval before incubating with the CD11b antibody, which enzyme is used?

    A: The protocol is referencting the PIER method using Proteinase K as the enzyme.

  • Q: We need a CD11b antibody for IHC-P on mouse tissue conjugated to FITC, do you have one that will work?

    A: We have 3 CD11b antibodies for IHC-P and just one CD11 b antibody we offer conjugated to FITC, NB110-89474F.

  • Q: What types of cells can this CD11b antibody be used as a marker for?

    A: A study used this CD11b antibody to stain granulocytes in mouse uterine tissue in IHC. CD11b is also expressed on other leukocytes such as monocytes, macrophages, and natural killer cells.

  • Q: Do you know if this CD11b antibody can be used in CD11b positive cell depletion? 

    A: This particular CD11b antibody is not reccomended for depletion studies due to the preservative used; however, our CD11b antibody NBP1-06650 is offered in a preservative free format and has been validated for blocking.

  • Q: I am looking for a Mac-1 (microglia cell marker) antibody to do immunostaining with my mouse brain and I checked, you have a lot of antibodies for this biomarker. I don't know which one is the best to be used for immunohistology on mouse brain tissue. Could you please help with this?

    A: I would recommend NB110-89474. This antibody has been published in 11 scientific articles, including several times in IHC in mouse. As long as CD11b is expressed in your sample, it should work just fine and is backed by our 100% Novus Guarantee.

  • Q: I'm not sure if this will work for me, can I get a free sample of your CD11b antibody to test?

    A: We don't offer free samples but we do offer this CD11b antibody in a trial size of 0.025 ml at a reduced cost, all antibodies are backed by our 100% guarantee to work in all validated species and applications on the product's web page.

  • Q: Is CD11b antibody also staining neutrophils in the brain

    A: CD11b is typically used as a marker for granulocytes and macrophages. You may need a combination of markers to specifically identify neutrophils

  • Q: Looking for a bone marrow macrophage marker can you recommend a CD11b antibody for ICC?

    A: I would recommend NB110-89474 which is our most popular CD11b antibody and has been validated in ICC and cited in 18 publications.

  • Q: The protocol says to do enzymatic antigen retrieval before incubating with the CD11b antibody, which enzyme is used?

    A: The protocol is referencting the PIER method using Proteinase K as the enzyme.

  • Q: We need a CD11b antibody for IHC-P on mouse tissue conjugated to FITC, do you have one that will work?

    A: We have 3 CD11b antibodies for IHC-P and just one CD11 b antibody we offer conjugated to FITC, NB110-89474F.

  • Q: What types of cells can this CD11b antibody be used as a marker for?

    A: A study used this CD11b antibody to stain granulocytes in mouse uterine tissue in IHC. CD11b is also expressed on other leukocytes such as monocytes, macrophages, and natural killer cells.

Showing  1 - 58 FAQs Showing All
View all FAQs for Antibodies