GATA-2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82581

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human, Mouse

Predicted:

Mouse (97%), Rat (96%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western

Cited:

Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Immunohistochemistry Whole-Mount, Western Blot, Immunocytochemistry/ Immunofluorescence, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for GATA-2 Antibody - BSA Free

Western Blot: GATA-2 Antibody [NBP1-82581]

Western Blot: GATA-2 Antibody [NBP1-82581]

GATA-2-Antibody-Western-Blot-NBP1-82581-img0026.jpg
Immunocytochemistry/ Immunofluorescence: GATA-2 Antibody [NBP1-82581]

Immunocytochemistry/ Immunofluorescence: GATA-2 Antibody [NBP1-82581]

Immunocytochemistry/Immunofluorescence: GATA-2 Antibody [NBP1-82581] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: GATA-2 Antibody [NBP1-82581]

Immunohistochemistry-Paraffin: GATA-2 Antibody [NBP1-82581]

Immunohistochemistry-Paraffin: GATA-2 Antibody [NBP1-82581] - Staining of human placenta shows nuclear positivity in trophoblastic cells.
Western Blot: GATA-2 Antibody [NBP1-82581]

Western Blot: GATA-2 Antibody [NBP1-82581]

Western Blot: GATA-2 Antibody [NBP1-82581] - Analysis in human cell line SH-SY5Y.
Immunohistochemistry-Paraffin: GATA-2 Antibody [NBP1-82581]

Immunohistochemistry-Paraffin: GATA-2 Antibody [NBP1-82581]

Immunohistochemistry-Paraffin: GATA-2 Antibody [NBP1-82581] - Staining of human kidney shows nuclear positivity in cells in tubules.
Simple Western: GATA-2 Antibody [NBP1-82581]

Simple Western: GATA-2 Antibody [NBP1-82581]

Simple Western: GATA-2 Antibody [NBP1-82581] - Simple Western lane view shows a specific band for GATA2 in 0.2 mg/mL of HELA lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Simple Western: GATA-2 Antibody [NBP1-82581]

Simple Western: GATA-2 Antibody [NBP1-82581]

Simple Western: GATA-2 Antibody [NBP1-82581] - Electropherogram image(s) of corresponding Simple Western lane view. GATA-2 antibody was used at 1:100 dilution on HELA lysate(s).
GATA-2 Antibody

Western Blot: GATA-2 Antibody [NBP1-82581] -

Western Blot: GATA-2 Antibody [NBP1-82581] - Knock-down of GATA2 gene expression decreases proliferation, migration & matrigel invasion of prostate cancer cellsTreatment of LNCaP cells with siGATA2 leads to A, a marked reduction in GATA2 protein levels; & B, a marked decrease in cell proliferation. C, a monolayer of LNCaP cells was scratched to examine the rate of cell migration into the wounded area. The bar graph represents the percentage of cell-recovered wound areas after 8 hours of incubation (*, p<0.01). Representative images of the wound captured at different time points are shown (at right). D & E, cell migration & matrigel invasion assays show a marked decrease in cell motility & tissue invasiveness of siGATA2-treated LNCaP cells. Bar graphs show the percentage of migrated/invaded cells after a 20-hr incubation. Results (A-E) shown are representative of three individual experiments with error bars representing standard deviation based on triplicates. Statistical significance was established using the Student's t-test. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/24448395), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
GATA-2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: GATA-2 Antibody - BSA Free [NBP1-82581] -

GATA2 regulation by matrix stiffness in LECs. a, b qRT-PCR analysis of GATA2 in human LECs (a) and primary mouse LECs (b) grown on soft (0.2 kPa) or stiff (25 kPa) matrix. n = 3 experiments, mean +/- s.e.m. p value, one-sample t-test. c Immunofluorescence of human LECs grown on stiff and soft matrix using antibodies against GATA2 (green) and VE-cadherin (red), and for DAPI to show nuclei (grey). LECs grown on soft matrix exhibit an overall higher expression of GATA2 as indicated by higher immunofluorescence intensity in both the nucleus and cytoplasm and have an elongated shape and a distorted nucleus. d Quantification of nuclear and cytoplasmic GATA2 protein in human LECs grown on soft (0.2 kPa) or stiff (25 kPa) matrix. Data represent mean pixel intensity (n = 8 images with 8–24 cells per image (soft), and n = 8 images with 21–37 cells per image (stiff) from 3 experiments) +/- s.e.m. p value, unpaired Student’s t-test. Scale bars: 50 um Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/29666442), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for GATA-2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25 - 2 ug/mL

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Simple Western

1:100

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in HEL, separated by Size, antibody dilution of 1:100, apparent MW was 66 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.

Reviewed Applications

Read 1 review rated 5 using NBP1-82581 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GATA-2

The GATA family of transcription factors, which contain zinc fingers in their DNA binding domain, have emerged as candidate regulators of gene expression in hematopoietic cells (Tsai et al., 1994 [PubMed 8078582]). GATA1 (MIM 305371) is essential for normal primitive and definitive erythropoiesis and is expressed at high levels in erythroid cells, mast cells, and megakaryocytes. GATA2 is expressed in hematopoietic progenitors, including early erythroid cells, mast cells, and megakaryocytes, and also in nonhematopoietic embryonic stem cells. In chicken erythroid progenitors, forced expression of GATA2 promotes proliferation at the expense of differentiation (Briegel et al., 1993 [PubMed 8504932]). GATA3 (MIM 131320) expression is restricted to T-lymphoid cells and some nonhematopoietic cell types, including embryonic stem cells.[supplied by OMIM]

Alternate Names

GATA2

Entrez Gene IDs

2624 (Human)

Gene Symbol

GATA2

UniProt

Additional GATA-2 Products

Product Documents for GATA-2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GATA-2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for GATA-2 Antibody - BSA Free

Customer Reviews for GATA-2 Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used GATA-2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 11 review Showing All
Filter By:
  • GATA-2 Antibody
    Name: Anonymous
    Application: Immunoprecipitation
    Sample Tested: Cancer cell lysates
    Species: Human
    Verified Customer | Posted 06/29/2020
    Antibody is great. I tried many different companies, none of them works.
    GATA-2 Antibody - BSA Free NBP1-82581

There are no reviews that match your criteria.

Showing  1 - 11 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies