GATA-2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-82581
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Human, Mouse
Predicted:
Mouse (97%), Rat (96%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western
Cited:
Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Immunohistochemistry Whole-Mount, Western Blot, Immunocytochemistry/ Immunofluorescence, IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARG
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for GATA-2 Antibody - BSA Free
Western Blot: GATA-2 Antibody [NBP1-82581]
GATA-2-Antibody-Western-Blot-NBP1-82581-img0026.jpgImmunocytochemistry/ Immunofluorescence: GATA-2 Antibody [NBP1-82581]
Immunocytochemistry/Immunofluorescence: GATA-2 Antibody [NBP1-82581] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green. Antibody staining is shown in green.Immunohistochemistry-Paraffin: GATA-2 Antibody [NBP1-82581]
Immunohistochemistry-Paraffin: GATA-2 Antibody [NBP1-82581] - Staining of human placenta shows nuclear positivity in trophoblastic cells.Western Blot: GATA-2 Antibody [NBP1-82581]
Western Blot: GATA-2 Antibody [NBP1-82581] - Analysis in human cell line SH-SY5Y.Immunohistochemistry-Paraffin: GATA-2 Antibody [NBP1-82581]
Immunohistochemistry-Paraffin: GATA-2 Antibody [NBP1-82581] - Staining of human kidney shows nuclear positivity in cells in tubules.Simple Western: GATA-2 Antibody [NBP1-82581]
Simple Western: GATA-2 Antibody [NBP1-82581] - Simple Western lane view shows a specific band for GATA2 in 0.2 mg/mL of HELA lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.Simple Western: GATA-2 Antibody [NBP1-82581]
Simple Western: GATA-2 Antibody [NBP1-82581] - Electropherogram image(s) of corresponding Simple Western lane view. GATA-2 antibody was used at 1:100 dilution on HELA lysate(s).Western Blot: GATA-2 Antibody [NBP1-82581] -
Western Blot: GATA-2 Antibody [NBP1-82581] - Knock-down of GATA2 gene expression decreases proliferation, migration & matrigel invasion of prostate cancer cellsTreatment of LNCaP cells with siGATA2 leads to A, a marked reduction in GATA2 protein levels; & B, a marked decrease in cell proliferation. C, a monolayer of LNCaP cells was scratched to examine the rate of cell migration into the wounded area. The bar graph represents the percentage of cell-recovered wound areas after 8 hours of incubation (*, p<0.01). Representative images of the wound captured at different time points are shown (at right). D & E, cell migration & matrigel invasion assays show a marked decrease in cell motility & tissue invasiveness of siGATA2-treated LNCaP cells. Bar graphs show the percentage of migrated/invaded cells after a 20-hr incubation. Results (A-E) shown are representative of three individual experiments with error bars representing standard deviation based on triplicates. Statistical significance was established using the Student's t-test. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/24448395), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunocytochemistry/ Immunofluorescence: GATA-2 Antibody - BSA Free [NBP1-82581] -
GATA2 regulation by matrix stiffness in LECs. a, b qRT-PCR analysis of GATA2 in human LECs (a) and primary mouse LECs (b) grown on soft (0.2 kPa) or stiff (25 kPa) matrix. n = 3 experiments, mean +/- s.e.m. p value, one-sample t-test. c Immunofluorescence of human LECs grown on stiff and soft matrix using antibodies against GATA2 (green) and VE-cadherin (red), and for DAPI to show nuclei (grey). LECs grown on soft matrix exhibit an overall higher expression of GATA2 as indicated by higher immunofluorescence intensity in both the nucleus and cytoplasm and have an elongated shape and a distorted nucleus. d Quantification of nuclear and cytoplasmic GATA2 protein in human LECs grown on soft (0.2 kPa) or stiff (25 kPa) matrix. Data represent mean pixel intensity (n = 8 images with 8–24 cells per image (soft), and n = 8 images with 21–37 cells per image (stiff) from 3 experiments) +/- s.e.m. p value, unpaired Student’s t-test. Scale bars: 50 um Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/29666442), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for GATA-2 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25 - 2 ug/mL
Immunohistochemistry
1:20 - 1:50
Immunohistochemistry-Paraffin
1:20 - 1:50
Simple Western
1:100
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in HEL, separated by Size, antibody dilution of 1:100, apparent MW was 66 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
See Simple Western Antibody Database for Simple Western validation: Tested in HEL, separated by Size, antibody dilution of 1:100, apparent MW was 66 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
Reviewed Applications
Read 1 review rated 5 using NBP1-82581 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: GATA-2
Additional GATA-2 Products
Product Documents for GATA-2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for GATA-2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for GATA-2 Antibody - BSA Free
Customer Reviews for GATA-2 Antibody - BSA Free (1)
5 out of 5
1 Customer Rating
Have you used GATA-2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 的
1 review
Showing All
Filter By:
-
Application: ImmunoprecipitationSample Tested: Cancer cell lysatesSpecies: HumanVerified Customer | Posted 06/29/2020Antibody is great. I tried many different companies, none of them works.
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...