HMGB1/HMG-1 Antibody (1C4T5)

Novus Biologicals | Catalog # NBP3-15755

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Knockout Validated, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 1C4T5 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 100-200 of human HMGB1/HMG-1 (P09429). SAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HMGB1/HMG-1 Antibody (1C4T5)

HMGB1/HMG-1 Antibody (1C4T5)

Western Blot: HMGB1/HMG-1 Antibody (1C4T5) [HMGB1/HMG-1] -

Western Blot: HMGB1/HMG-1 Antibody (1C4T5) [HMGB1/HMG-1] - Western blot analysis of lysates from wild type (WT) and HMGB1/HMG-1 knockout (KO) HeLa cells using [KO Validated] HMGB1/HMG-1 Rabbit mAb at 1:6000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 0.5s.
HMGB1/HMG-1 Antibody (1C4T5)

Immunocytochemistry/Immunofluorescence: HMGB1/HMG-1 Antibody (1C4T5) [NBP3-15755] -

Immunocytochemistry/Immunofluorescence: HMGB1/HMG-1 Antibody (1C4T5) [NBP3-15755] - Confocal imaging of NIH-3T3 cells using [KO Validated] HMGB1 Rabbit mAb (dilution 1:100) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb (dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
HMGB1/HMG-1 Antibody (1C4T5)

Immunohistochemistry: HMGB1/HMG-1 Antibody (1C4T5) [HMGB1/HMG-1] -

Immunohistochemistry: HMGB1/HMG-1 Antibody (1C4T5) [HMGB1/HMG-1] - Immunohistochemistry analysis of paraffin-embedded Rat liver using [KO Validated] HMGB1/HMG-1 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
HMGB1/HMG-1 Antibody (1C4T5)

Immunohistochemistry: HMGB1/HMG-1 Antibody (1C4T5) [HMGB1/HMG-1] -

Immunohistochemistry: HMGB1/HMG-1 Antibody (1C4T5) [HMGB1/HMG-1] - Immunohistochemistry analysis of paraffin-embedded Mouse testis using [KO Validated] HMGB1/HMG-1 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
HMGB1/HMG-1 Antibody (1C4T5)

Immunohistochemistry: HMGB1/HMG-1 Antibody (1C4T5) [HMGB1/HMG-1] -

Immunohistochemistry: HMGB1/HMG-1 Antibody (1C4T5) [HMGB1/HMG-1] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer using [KO Validated] HMGB1/HMG-1 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
HMGB1/HMG-1 Antibody (1C4T5)

Immunohistochemistry: HMGB1/HMG-1 Antibody (1C4T5) [HMGB1/HMG-1] -

Immunohistochemistry: HMGB1/HMG-1 Antibody (1C4T5) [HMGB1/HMG-1] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using [KO Validated] HMGB1/HMG-1 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
HMGB1/HMG-1 Antibody (1C4T5)

Immunohistochemistry: HMGB1/HMG-1 Antibody (1C4T5) [HMGB1/HMG-1] -

Immunohistochemistry: HMGB1/HMG-1 Antibody (1C4T5) [HMGB1/HMG-1] - Immunohistochemistry analysis of paraffin-embedded Mouse colon using [KO Validated] HMGB1/HMG-1 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
HMGB1/HMG-1 Antibody (1C4T5)

Immunohistochemistry: HMGB1/HMG-1 Antibody (1C4T5) [HMGB1/HMG-1] -

Immunohistochemistry: HMGB1/HMG-1 Antibody (1C4T5) [HMGB1/HMG-1] - Immunohistochemistry analysis of paraffin-embedded Mouse liver using [KO Validated] HMGB1/HMG-1 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
HMGB1/HMG-1 Antibody (1C4T5)

Western Blot: HMGB1/HMG-1 Antibody (1C4T5) [NBP3-15755] -

Western Blot: HMGB1/HMG-1 Antibody (1C4T5) [NBP3-15755] - Western blot analysis of various lysates using [KO Validated] HMGB1/HMG-1 Rabbit mAb at 1:6000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 0.5s.

Applications for HMGB1/HMG-1 Antibody (1C4T5)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: HMGB1/HMG-1

HMGB1 and HMGB2 are part of the chromatin non-histone high mobility group proteins 1 and 2. HMGB1 and HMGB2 (containing multiple HMG-boxes) are conserved domains of 80 amino acids which mediate the DNA binding of many proteins. HMG box domains recognize DNA structure. Both HMGB1 and HMGB2 contain a N-terminal HMG box, a central HMG box, and an acidic carboxy terminus. The acidic tails of HMGB1 and HMGB2 contain multiple serine residues which match the phosphorylation consensus sites of casein kinase II, and phosphorylation of this domain appears to be important for proper functioning of these proteins. HMGB1 and HMGB2 have been shown to facilitate the binding of various sequence-specific transcription factors to their respective DNA binding sites. HMGB1 and HMGB2 may also serve as architectural factors that recognize and mediate DNA structural changes that accompany various events such as DNA repair, transcription, and replication.

Long Name

High Mobility Group Protein 1

Alternate Names

HMG-1, HMG1

Gene Symbol

HMGB1

Additional HMGB1/HMG-1 Products

Product Documents for HMGB1/HMG-1 Antibody (1C4T5)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HMGB1/HMG-1 Antibody (1C4T5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HMGB1/HMG-1 Antibody (1C4T5)

There are currently no reviews for this product. Be the first to review HMGB1/HMG-1 Antibody (1C4T5) and earn rewards!

Have you used HMGB1/HMG-1 Antibody (1C4T5)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...