Ki67/MKI67 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-54656

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This KI67/MKI67 Antibody was developed against a Recombinant Protein corresponding to amino acids 402-55 from Human KI67/MKI67: PAKVEDAADSATKPENLSSKTRGSIPTDVEVLPTETEIHNEPFLTLWLTQVERKIQKDSLSKPEKLGTTAGQMCSGLPGLSSVDINNFGDSINESEGIPLKRRRVSFGGHLRPELFDENLPPNTPLKRGEAPTKRKSLVMHTPPVLKKIIK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

359 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Ki67/MKI67 Antibody - BSA Free

Immunohistochemistry-Paraffin: Ki67/MKI67 Antibody [NBP2-54656]

Immunohistochemistry-Paraffin: Ki67/MKI67 Antibody [NBP2-54656]

Immunohistochemistry-Paraffin: Ki67/MKI67 Antibody [NBP2-54656] - Analysis in human bone marrow and skeletal muscle tissues. Corresponding MKI67 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Ki67/MKI67 Antibody [NBP2-54656]

Immunohistochemistry-Paraffin: Ki67/MKI67 Antibody [NBP2-54656]

Immunohistochemistry-Paraffin: Ki67/MKI67 Antibody [NBP2-54656] - Staining of human bone marrow shows strong nuclear positivity in hematopoietic cells.
Immunohistochemistry-Paraffin: Ki67/MKI67 Antibody [NBP2-54656]

Immunohistochemistry-Paraffin: Ki67/MKI67 Antibody [NBP2-54656]

Immunohistochemistry-Paraffin: Ki67/MKI67 Antibody [NBP2-54656] - Staining of human small intestine shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: Ki67/MKI67 Antibody [NBP2-54656]

Immunohistochemistry-Paraffin: Ki67/MKI67 Antibody [NBP2-54656]

Immunohistochemistry-Paraffin: Ki67/MKI67 Antibody [NBP2-54656] - Staining of human skin shows moderate to string nuclear positivity in a subset of keratinocytes.
Immunohistochemistry-Paraffin: Ki67/MKI67 Antibody [NBP2-54656]

Immunohistochemistry-Paraffin: Ki67/MKI67 Antibody [NBP2-54656]

Immunohistochemistry-Paraffin: Ki67/MKI67 Antibody [NBP2-54656] - Staining of human lymph node shows moderate to strong nuclear positivity in germinal center cells.
Immunohistochemistry-Paraffin: Ki67/MKI67 Antibody [NBP2-54656]

Immunohistochemistry-Paraffin: Ki67/MKI67 Antibody [NBP2-54656]

Immunohistochemistry-Paraffin: Ki67/MKI67 Antibody [NBP2-54656] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Ki67/MKI67 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: Ki67/MKI67 Antibody [NBP2-54656]

Immunocytochemistry/ Immunofluorescence: Ki67/MKI67 Antibody [NBP2-54656]

Staining of human cell line A-431 shows localization to nucleus & nucleoli.

Applications for Ki67/MKI67 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-P, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Ki67/MKI67

Ki67 is a nuclear protein associated with proliferation, named after its discovery in a Hodgkin's lymphoma-derived cell line by Scholzer and Gerdes at Kiel University, Germany (1). This proliferation marker is expressed during active phases of the cell cycle (late G1, S, G2 and M), whereas the protein remains undetectable in the G0 phase. Ki67 has two main isoforms with theoretical molecular weights of 319 kDa and 359 kDa. Its abundance is tightly regulated by synthesis and degradation with an estimated half-life of 60-90 min, regardless of its position in the cell cycle. Ki67 has been shown to be involved in ribosomal biogenesis, heterochromatin maintenance, and mitotic chromosome separation (2).

Detection of Ki67 by immunostaining is commonly used as a proliferation marker in solid tumors, as well as certain hematological malignancies (3-5). The Ki67 index, which reports on positive Ki67 stained tumor cell nuclei, has been extensively studied as a prognostic biomarker in cancers such as breast cancer and cervical cancer.

References

1. Gerdes J, Schwab U, Lemke H, Stein H. (1983) Production of a mouse monoclonal antibody reactive with a human nuclear antigen associated with cell proliferation. Int J Cancer. 31:13-20. PMID: 6339421

2. Starborg M, Gell K, Brundell E and Hoog C. (1996) The murine Ki-67 cell proliferation antigen accumulates in the nucleolar and heterochromatic regions of interphase cells and at the periphery of the mitotic chromosomes in a process essential for cell cycle progression. J Cell Sci. 109:143-153. 1996

3. Karamitopoulou E, Perentes E, Tolnay M, Probst A. (1998) Prognostic significance of MIB-1, p53, and bcl-2 immunoreactivity in meningiomas. Hum Pathol. 29(2):140-5. PMID: 9490273

4. Geyer FC, Rodrigues DN, Weigelt B and Reis-Filho JS. (2012) Molecular classification of estrogen receptor-positive/luminal breast cancers. Adv Anat Pathol. 19(1):39-53. PMID: 22156833

5. Ikenberg H, Bergeron C, Schmidt D, Griesser H, Alameda F, Angeloni C, Bogers J, Dachez R, Denton K, Hariri J, Keller T, von Knebel Doeberitz M, Neumann HH, Puig-Tintore LM, Sideri M, Rehm S, Ridder R; PALMS Study Group. (2013) Screening for cervical cancer precursors with p16/Ki-67 dual-stained cytology: results of the PALMS study. J Natl Cancer Inst. 105(20):1550-7. PMID: 24096620

Long Name

Antigen Identified by Monoclonal Antibody Ki67

Alternate Names

Ki-67, KIA, MIB-1, MKI67, PPP1R105, TSG126

Gene Symbol

MKI67

Additional Ki67/MKI67 Products

Product Documents for Ki67/MKI67 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Ki67/MKI67 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Ki67/MKI67 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Ki67/MKI67 Antibody - BSA Free and earn rewards!

Have you used Ki67/MKI67 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Ki67/MKI67 Antibody - BSA Free

Showing  1 - 33 FAQs Showing All
  • Q: Is there a clone number for this Ki67 antibody?

    A: This antibody is polyclonal, and thus it does not have a clone number.

  • Q: Whats the concentration of this Ki67/MKI67 Antibody?

    A:  Optimal concentrations and conditions for each application should be determined by the user.

  • Q: Whats the concentration of this Ki67/MKI67 Antibody?

    A: The concentration is lot specific available upon request.

  • Q: Is there a clone number for this Ki67 antibody?

    A: This antibody is polyclonal, and thus it does not have a clone number.

  • Q: Whats the concentration of this Ki67/MKI67 Antibody?

    A:  Optimal concentrations and conditions for each application should be determined by the user.

  • Q: Whats the concentration of this Ki67/MKI67 Antibody?

    A: The concentration is lot specific available upon request.

  • Q: Is there a clone number for this Ki67 antibody?

    A: This antibody is polyclonal, and thus it does not have a clone number.

  • Q: Whats the concentration of this Ki67/MKI67 Antibody?

    A:  Optimal concentrations and conditions for each application should be determined by the user.

  • Q: Whats the concentration of this Ki67/MKI67 Antibody?

    A: The concentration is lot specific available upon request.

Showing  1 - 33 FAQs Showing All
View all FAQs for Antibodies
Loading...