Lamin B1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-03711

Novus Biologicals
Loading...

Key Product Details

Validated by

Biological Validation

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Chromatin Immunoprecipitation (ChIP)

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 397-586 of human Lamin B1 (NP_005564.1). RVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

66 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Lamin B1 Antibody - BSA Free

Western Blot: Lamin B1 AntibodyAzide and BSA Free [NBP3-03711]

Western Blot: Lamin B1 AntibodyAzide and BSA Free [NBP3-03711]

Western Blot: Lamin B1 Antibody [NBP3-03711] - Analysis of extracts of various cell lines, using Lamin B1 antibody at 1:1000 dilution.L929 cells were treated by staurosporine(1 uM) for 3 hour. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.Exposure time: 30s.
Western Blot: Lamin B1 AntibodyAzide and BSA Free [NBP3-03711]

Western Blot: Lamin B1 AntibodyAzide and BSA Free [NBP3-03711]

Western Blot: Lamin B1 Antibody [NBP3-03711] - Analysis of extracts of various cell lines, using Lamin B1 antibody at 1:1000 dilution.Jurkat cells were treated by Etoposide (25 uM) at 37c for 5 hours.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 10s.
Immunoprecipitation: Lamin B1 Antibody - Azide and BSA Free [NBP3-03711]

Immunoprecipitation: Lamin B1 Antibody - Azide and BSA Free [NBP3-03711]

Immunoprecipitation: Lamin B1 Antibody [NBP3-03711] - Analysis of 300ug extracts of MCF7 cells using 3ug Lamin B1 antibody. Western blot was performed from the immunoprecipitate using Lamin B1 antibody at a dilition of 1:1000.
Lamin B1 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] -

Immunocytochemistry/ Immunofluorescence: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Immunofluorescence analysis of U2OS cells using Lamin B1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Lamin B1 Antibody - Azide and BSA Free

Immunohistochemistry: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] -

Immunohistochemistry: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Immunohistochemistry analysis of paraffin-embedded Human breast cancer using Lamin B1 Rabbit pAb at dilution of 1:150 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Lamin B1 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] -

Immunocytochemistry/ Immunofluorescence: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Confocal immunofluorescence analysis of HeLa cells using Lamin B1 Rabbit pAb at dilution of 1:200. Blue: DAPI for nuclear staining.
Lamin B1 Antibody - Azide and BSA Free

Immunoprecipitation: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] -

Immunoprecipitation: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Immunoprecipitation of Lamin B1 in 300 ug extracts from Jurkat cells using 0.5 ug Lamin B1 Rabbit pAb. Western blot analysis was performed using Lamin B1 Rabbit pAb at 1:1000 dilution.
Lamin B1 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] -

Immunocytochemistry/ Immunofluorescence: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Immunofluorescence analysis of C6 cells using Lamin B1 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Lamin B1 Antibody - Azide and BSA Free

Chromatin Immunoprecipitation: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] -

Chromatin Immunoprecipitation: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Chromatin immunoprecipitation was performed with cross-linked chromatin from HeLa, using Lamin-B1 Rabbit mAb and rabbit IgG. The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram compares the ratio of the immunoprecipitated DNA versus the input.
Lamin B1 Antibody - Azide and BSA Free

Chromatin Immunoprecipitation: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] -

Chromatin Immunoprecipitation: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Chromatin immunoprecipitation analysis of extracts of HeLa cells, using Lamin B1 Rabbit pAb antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
Lamin B1 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] -

Immunocytochemistry/ Immunofluorescence: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Confocal immunofluorescence analysis of HeLa cells using Lamin B1 Rabbit pAb at dilution of 1:200. Blue: DAPI for nuclear staining.
Lamin B1 Antibody - Azide and BSA Free

Immunohistochemistry: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] -

Immunohistochemistry: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Immunohistochemistry analysis of paraffin-embedded Rat brain using Lamin B1 Rabbit pAb at dilution of 1:150 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Lamin B1 Antibody - Azide and BSA Free

Immunohistochemistry: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] -

Immunohistochemistry: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using Lamin B1 Rabbit pAb at dilution of 1:150 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Lamin B1 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] -

Immunocytochemistry/ Immunofluorescence: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Immunofluorescence analysis of PC-12 cells using Lamin B1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Lamin B1 Antibody - Azide and BSA Free

Immunoprecipitation: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] -

Immunoprecipitation: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Immunoprecipitation analysis of 300 ug extracts of HeLa cells using 3 ug Lamin B1 antibody. Western blot was performed from the immunoprecipitate using Lamin B1 antibody at a dilution of 1:1000.
Lamin B1 Antibody - Azide and BSA Free

Western Blot: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] -

Western Blot: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Western blot analysis of various lysates using Lamin B1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1min.
Lamin B1 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] -

Immunocytochemistry/ Immunofluorescence: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Immunofluorescence analysis of NIH/3T3 cells using Lamin B1 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for Lamin B1 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation (ChIP)

5μg antibody for 10μg-15μg of Chromatin

ELISA

Recommended starting concentration is 1 μg/mL

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Immunoprecipitation

1:500 - 1:1000

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Lamin B1

Nuclear lamins form a network of intermediate-type filaments at the nucleoplasmic site of the nuclear membrane.Two main subtypes of nuclear lamins can be distinguished, i.e. A-type lamins and B-type lamins. The A-type lamins comprise a set of three proteins arising from the same gene by alternative splicing, i.e. lamin A, lamin C and lamin Adel 10, while the B-type lamins include two proteins arising from two distinct genes, i.e. lamin B1 and lamin B2.

Alternate Names

ADLD, LMN2, LMNB1

Gene Symbol

LMNB1

Additional Lamin B1 Products

Product Documents for Lamin B1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Lamin B1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Related Research Areas

Customer Reviews for Lamin B1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Lamin B1 Antibody - BSA Free and earn rewards!

Have you used Lamin B1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Lamin B1 Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: I'm looking for human lamin antibodies that might cross react with Drosophila lamins. I've found a few that I'm interested in, one of which comes in a smaller sample size. The other two do not have a smaller size ordering option. I was wondering if it would be possible to get these other antibodies in a smaller size as well, so we can test reactivity with Drosophila lamins before ordering the full-sized product?

    A:

    We have a wide range of antibodies to human Lamin. Unfortunately none of these has yet been tested against Drosophila samples, however you may be interested in our Innovator's Reward Program. This allows you to try our primary antibodies in an untested species or application, without the financial risk of failure. To participate you simply complete an online review with an image, detailing the positive or negative results of your study, and in return you receive a discount voucher for 100% of the purchase price of the reviewed product. We are unable to offer free samples of our antibodies but, as you rightly point out, some are available as smaller, sample size aliquots. If a sample size is not listed for a product I am afraid we are unable to offer a smaller aliquot than those already listed.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...