Neuropilin-1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85763

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Mouse

Predicted:

Mouse (97%), Rat (92%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin

Cited:

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Neuropilin-1 Antibody was developed against a Recombinant Protein corresponding to amino acids: EGRVLLHKSLKLYQVIFEGEIGKGNLGGIAVDDISINNHISQEDCAKPADLDKKNPEIKIDETGSTPGYEGEGE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

103 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Neuropilin-1 Antibody - BSA Free

Neuropilin-1 Antibody - BSA Free Immunohistochemistry-Paraffin: Neuropilin-1 Antibody - BSA Free [NBP1-85763]

Immunohistochemistry-Paraffin: Neuropilin-1 Antibody - BSA Free [NBP1-85763]

Staining of human skeletal muscle shows low positivity in myocytes as expected.
Neuropilin-1 Antibody - BSA Free Immunohistochemistry-Paraffin: Neuropilin-1 Antibody - BSA Free [NBP1-85763]

Immunohistochemistry-Paraffin: Neuropilin-1 Antibody - BSA Free [NBP1-85763]

Staining of human placenta shows moderate granular cytoplasmic positivity in trophoblastic cells.
Neuropilin-1 Antibody - BSA Free Immunohistochemistry-Paraffin: Neuropilin-1 Antibody - BSA Free [NBP1-85763]

Immunohistochemistry-Paraffin: Neuropilin-1 Antibody - BSA Free [NBP1-85763]

Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Neuropilin-1 Antibody - BSA Free Immunohistochemistry-Paraffin: Neuropilin-1 Antibody - BSA Free [NBP1-85763]

Immunohistochemistry-Paraffin: Neuropilin-1 Antibody - BSA Free [NBP1-85763]

Staining of human colon shows moderate granular cytoplasmic positivity in glandular cells.

Applications for Neuropilin-1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Neuropilin-1

Neuropilin-1 (also known as Npn-1, NRP1, neuropilin, or CD304/BDCA4) is a 923 amino acid (aa) type I transmembrane glycoprotein (theoretical molecular weight 130-140 kDa) located on human chromosome 10p11.22 that encodes multiple intact and soluble isoforms. The 623 aa extracellular domain (ECD) of this human cell surface receptor includes two CUB (complement-binding) domains, two F5/8 domains with homology to coagulation factors V and VIII, and a MAM (meprin) domain. The ECD of human Neuropilin-1 shares 92-95% aa sequence identity with mouse, rat, bovine, and canine Npn-1. The MAM domains of neuropilins are involved in the formation of homo- and hetero-oligomers in the absence of ligands. Neuropilin-1 expression is found in neuronal, endothelial and tumor cells as well as epithelial cells such as in the respiratory, gastrointestinal, lower urological tracts, thyroid, parathyroid and thymus gland (1,2).
Initially found to play an essential role in axon growth and guidance, NRP1 serves as a multifunctional co-receptor for class III semaphorins and heparin-binding members of the VEGF family, participating in regulation of angiogenesis, neuronal development, cell survival, migration and tumor-invasion. Neuropilin-1 has been implicated in viral infections and T-cell activation and is also described as a marker of regulatory T (Treg) cells (3). In COVID-19 infections, studies have shown NRP1 participates in viral infection via NRP1 neutralizing antibodies and binds the SARS-CoV-2 Spike protein, suggesting NRP1 may contribute to viral transport and viral internalization by endocytosis (4).

References

1. Wild JRL, Staton CA, Chapple K, Corfe BM. (2012) Neuropilins: Expression and Roles in the Epithelium. Int J Exp Pathol. 93(2):81-103. PMID: 22414290

2. Bielenberg DR, Pettaway CA, Takashima S, Klagsbrun M. (2006) Neuropilins in Neoplasms: Expression, Regulation, and Function. Exp Cell Res. 312(5):584-93. PMID: 16445911

3. Tordjman R, Lepelletier Y, Lemarchandel V, Cambot M, Gaulard P, Hermine O, Romeo P-H. (2002). A Neuronal Receptor, neuropilin-1, Is Essential for the Initiation of the Primary Immune Response. Nat Immunol. 3(5):477-82. PMID: 11953749

4. Coronavirus research updates: Test frequency matters more than test sensitivity for stopping outbreaks. 2002 June 26. Nature.com

Alternate Names

BDCA-4, CD304, Neuropilin1, NRP1

Gene Symbol

NRP1

Additional Neuropilin-1 Products

Product Documents for Neuropilin-1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Neuropilin-1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Neuropilin-1 Antibody - BSA Free

Customer Reviews for Neuropilin-1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Neuropilin-1 Antibody - BSA Free and earn rewards!

Have you used Neuropilin-1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Neuropilin-1 Antibody - BSA Free

Showing  1 - 22 FAQs Showing All
  • Q: If this product is used in an application or species as a part of a customer review, will that validate this product in the application/species?

    A: If any of our primary antibodes are used in an untested application or species and it is shown to work through images from customer reviews or through publications, this validates the application/species for this product. Please check out our Innovator's Reward Program if you decide to test an antibody with a species or application that is not currently listed.

  • Q: What research areas can Neuropilin-1 antibodies be used in?

    A: Neuropilin-1 products can be applied in the following research areas: Adaptive Immunity, Angiogenesis, Breast Cancer, Cancer, Cardiovascular Biology, Neuroscience, and Virology Bacteria and Parasites.

  • Q: If this product is used in an application or species as a part of a customer review, will that validate this product in the application/species?

    A: If any of our primary antibodes are used in an untested application or species and it is shown to work through images from customer reviews or through publications, this validates the application/species for this product. Please check out our Innovator's Reward Program if you decide to test an antibody with a species or application that is not currently listed.

  • Q: What research areas can Neuropilin-1 antibodies be used in?

    A: Neuropilin-1 products can be applied in the following research areas: Adaptive Immunity, Angiogenesis, Breast Cancer, Cancer, Cardiovascular Biology, Neuroscience, and Virology Bacteria and Parasites.

Showing  1 - 22 FAQs Showing All
View all FAQs for Antibodies