NOV/CCN3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88154

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGC

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (80%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NOV/CCN3 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: NOV/CCN3 Antibody [NBP1-88154]

Immunocytochemistry/ Immunofluorescence: NOV/CCN3 Antibody [NBP1-88154]

Immunocytochemistry/Immunofluorescence: NOV/CCN3 Antibody [NBP1-88154] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.
NOV/CCN3 Antibody - BSA Free Immunohistochemistry-Paraffin: NOV/CCN3 Antibody - BSA Free [NBP1-88154]

Immunohistochemistry-Paraffin: NOV/CCN3 Antibody - BSA Free [NBP1-88154]

Analysis in human adrenal gland and skeletal muscle tissues using HPA019684 antibody. Corresponding NOV RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: NOV/CCN3 Antibody [NBP1-88154]

Immunohistochemistry-Paraffin: NOV/CCN3 Antibody [NBP1-88154]

Immunohistochemistry-Paraffin: NOV/CCN3 Antibody [NBP1-88154] - Staining of human adrenal gland shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: NOV/CCN3 Antibody [NBP1-88154]

Immunohistochemistry-Paraffin: NOV/CCN3 Antibody [NBP1-88154]

Immunohistochemistry-Paraffin: NOV/CCN3 Antibody [NBP1-88154] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
NOV/CCN3 Antibody - BSA Free Western Blot: NOV/CCN3 Antibody - BSA Free [NBP1-88154]

Western Blot: NOV/CCN3 Antibody - BSA Free [NBP1-88154]

Analysis in control (vector only transfected HEK293T lysate) and NOV over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Applications for NOV/CCN3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NOV/CCN3

CCN3 is encoded by this gene is a small secreted cysteine-rich protein and a member of the CCN family of regulatory proteins. CNN family proteins associate with the extracellular matrix and play an important role in cardiovascular and skeletal development, fibrosis and cancer development. [provided by RefSeq]

Long Name

Nephroblastoma Overexpressed Gene

Alternate Names

CCN3, IGFBP-9

Gene Symbol

CCN3

Additional NOV/CCN3 Products

Product Documents for NOV/CCN3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NOV/CCN3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NOV/CCN3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NOV/CCN3 Antibody - BSA Free and earn rewards!

Have you used NOV/CCN3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NOV/CCN3 Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: I am looking for the expression of CCN3/NOV in tumor cells and I am interested in finding an antibody that has a lot of data to support the antibody is working well. Can you make a recommendation?

    A:

    We have two antibodies, NBP1-88154 and NBP1-88155 that have been extremely well characterized by testing at the Human Protein Atlas. Please see the Human Protein Atlas website for full testing for these products.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...

Associated Pathways

Notch Signaling Pathways
Notch Signaling Pathway Thumbnail