p70 S6 Kinase/S6K Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38448

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Validated:

Human

Predicted:

Mouse (99%), Rat (99%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: VSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for p70 S6 Kinase/S6K Antibody - BSA Free

Western Blot: p70 S6 Kinase/S6K Antibody [NBP2-38448]

Western Blot: p70 S6 Kinase/S6K Antibody [NBP2-38448]

Western Blot: p70 S6 Kinase/S6K Antibody [NBP2-38448] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.
Immunocytochemistry/ Immunofluorescence: p70 S6 Kinase/S6K Antibody [NBP2-38448]

Immunocytochemistry/ Immunofluorescence: p70 S6 Kinase/S6K Antibody [NBP2-38448]

Immunocytochemistry/Immunofluorescence: p70 S6 Kinase/S6K Antibody [NBP2-38448] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Western Blot: p70 S6 Kinase/S6K Antibody [NBP2-38448]

Western Blot: p70 S6 Kinase/S6K Antibody [NBP2-38448]

Western Blot: p70 S6 Kinase/S6K Antibody [NBP2-38448] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG

Applications for p70 S6 Kinase/S6K Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: p70 S6 Kinase

S6K encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates several residues of the S6 ribosomal protein. The kinase activity of this protein leads to an increase in protein synthesis and cell proliferation. Amplification of the region of DNA encoding this gene and overexpression of this kinase are seen in some breast cancer cell lines. Alternate translational start sites have been described and alternate transcriptional splice variants have been observed but have not been thoroughly characterized.

Alternate Names

p70-alpha, RPS6KB1, S6K1, STK14A

Gene Symbol

RPS6KB1

UniProt

Additional p70 S6 Kinase Products

Product Documents for p70 S6 Kinase/S6K Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for p70 S6 Kinase/S6K Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for p70 S6 Kinase/S6K Antibody - BSA Free

There are currently no reviews for this product. Be the first to review p70 S6 Kinase/S6K Antibody - BSA Free and earn rewards!

Have you used p70 S6 Kinase/S6K Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies