PGLYRP1/PGRP-S Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92261

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PGLYRP1/PGRP-S Antibody - BSA Free

Immunohistochemistry-Paraffin: PGLYRP1/PGRP-S Antibody [NBP1-92261]

Immunohistochemistry-Paraffin: PGLYRP1/PGRP-S Antibody [NBP1-92261]

Immunohistochemistry-Paraffin: PGLYRP1/PGRP-S Antibody [NBP1-92261] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: PGLYRP1/PGRP-S Antibody [NBP1-92261]

Immunohistochemistry-Paraffin: PGLYRP1/PGRP-S Antibody [NBP1-92261]

Immunohistochemistry-Paraffin: PGLYRP1/PGRP-S Antibody [NBP1-92261] - Staining of human bone marrow shows strong cytoplasmic and nuclear positivity in hematopoietic cells.
Immunohistochemistry-Paraffin: PGLYRP1/PGRP-S Antibody [NBP1-92261]

Immunohistochemistry-Paraffin: PGLYRP1/PGRP-S Antibody [NBP1-92261]

Immunohistochemistry-Paraffin: PGLYRP1/PGRP-S Antibody [NBP1-92261] - Staining of human bone marrow shows high expression.
Immunohistochemistry-Paraffin: PGLYRP1/PGRP-S Antibody [NBP1-92261]

Immunohistochemistry-Paraffin: PGLYRP1/PGRP-S Antibody [NBP1-92261]

Immunohistochemistry-Paraffin: PGLYRP1/PGRP-S Antibody [NBP1-92261] - Staining in human bone marrow and cerebral cortex tissues using anti-PGLYRP1 antibody. Corresponding PGLYRP1 RNA-seq data are presented for the same tissues.

Applications for PGLYRP1/PGRP-S Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
HIER pH6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PGLYRP1/PGRP-S

The primary immune recognition is based on structures common among invading pathogens. Bacterial surface molecules, such as lipopolysaccharide (LPS) and peptidoglycan (PGN), are known to elicit immune reactions ranging from cytokine release to fever. Recently, a family of proteins called peptidoglycan recognition protein (PGRP) has been identified in mouse and human that binds to peptidoglycans expressed on Gram-positive bacteria. Peptidoglycan (PGN) is an essential cell wall component of virtually all bacteria (1,2) and, thus, it is an excellent target for recognition by the eukaryotic innate immune system. The PGRPs (PGRP-L, PGRP-S, PGRP-Ia, and PGRP-Ib) define a new family of human pattern recognition molecules (3). PGRP-L is primarily expressed in the liver. Although liver is not considered a primary immune organ, liver participates in host defenses by producing acute phase proteins (by hepatocytes) in response to infections and by clearing microorganisms from blood (4). PGRP-S is present in neutrophils and inhibits growth of Gram-positive bacteria and, therefore, may function as a neutrophil antibacterial protein (5). However, PGRP-S may have another, as yet unidentified function because in humans it is expressed in the bone marrow 50

Long Name

Peptidoglycan Recognition Protein Short/Peptidoglycan Recognition Protein 1

Alternate Names

PGRP-S, PGRPS, TAG7, TNFSF3L

Entrez Gene IDs

8993 (Human)

Gene Symbol

PGLYRP1

UniProt

Additional PGLYRP1/PGRP-S Products

Product Documents for PGLYRP1/PGRP-S Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PGLYRP1/PGRP-S Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for PGLYRP1/PGRP-S Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PGLYRP1/PGRP-S Antibody - BSA Free and earn rewards!

Have you used PGLYRP1/PGRP-S Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PGLYRP1/PGRP-S Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: What is the concentration of the following antibody? PGRP antibody (NBP1-92261), Lot no.: R42552

    A: The concentration of lot R42552 is 0.2 mg/ml.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...