Q: We are looking into protein kinase C-alpha antibodies for immunohistochemistry on formalin fixed, paraffin embedded tissue. I see that you have many antibodies, including several monoclonals. I wanted to confirm with you that the following antibodies are specific for C-alpha. NB600-201=MC5 (an older paper suggested that this might react with alpha, beta, gamm), NB110-57356=Y124, NB110-57353=Y143. Also, if you have an comparator data or feedback regarding PKC-alpha antibodies for IHC on FFPE, that would be very helpful. We would like to pick 1 antibody that is easy to titer and robust, so that we can move forward with our studies.

A: We have never heard any feedback that these cross-react with other PKC proteins. If you have seen data that MC5 may cross-react, then I would consider avoiding this antibody if you are concerned. The immunogens for NB110-57356 and NB110-57353 come from the N- and C-terminals, which is where the PKC proteins vary the most, so these are not expected to cross-react and we have had no feedback or testing data that suggests that they do. I would recommend NB110-57356, since it has been published with. You may want to review the published data to determine if it seems this antibody will suit your needs.

PKC alpha Antibody (2F11) - Azide and BSA Free

Novus Biologicals | Catalog # H00005578-M01

Submit a review

Product Documents

100% Guarantee

Product Specifications
Scientific Data
Applications
Preparation & Storage
Background
Product Documents
Specific Notices
Research Areas

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Proximity Ligation Assay

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG₁ kappa Clone # 2F11

Format

Azide and BSA Free

View all PKC alpha Primary Antibodies »

Product Specifications

Immunogen

PRKCA (NP_002728, 563 a.a. ~ 672 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV

Localization

Cytoplasmic and Nuclear

Specificity

PRKCA - protein kinase C, alpha

Clonality

Monoclonal

Host

Mouse

Isotype

IgG₁ kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for PKC alpha Antibody (2F11) - Azide and BSA Free

Western Blot: PKC alpha Antibody (2F11) [H00005578-M01]

Western Blot: PKC alpha Antibody (2F11) [H00005578-M01] - PRKCA monoclonal antibody (M01), clone 2F11 Analysis of PRKCA expression in HeLa.

Immunocytochemistry/ Immunofluorescence: PKC alpha Antibody (2F11) [H00005578-M01]

Immunocytochemistry/Immunofluorescence: PKC alpha Antibody (2F11) [H00005578-M01] - Analysis of monoclonal antibody to PRKCA on HeLa cell. Antibody concentration 10 ug/ml.

Immunohistochemistry-Paraffin: PKC alpha Antibody (2F11) [H00005578-M01]

Immunohistochemistry-Paraffin: PKC alpha Antibody (2F11) [H00005578-M01] - Analysis of monoclonal antibody to PRKCA on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 1 ug/ml.

Proximity Ligation Assay: PKC alpha Antibody (2F11) [H00005578-M01]

Proximity Ligation Assay: PKC alpha Antibody (2F11) [H00005578-M01] - Analysis of protein-protein interactions between FAS and PRKCA. HeLa cells were stained with anti-FAS rabbit purified polyclonal 1:1200 and anti-PRKCA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

ELISA: PKC alpha Antibody (2F11) [H00005578-M01]

ELISA: PKC alpha Antibody (2F11) [H00005578-M01] - Detection limit for recombinant GST tagged PRKCA is approximately 0.1ng/ml as a capture antibody.

View 2 more images

Applications for PKC alpha Antibody (2F11) - Azide and BSA Free

Application

Recommended Usage

Western Blot

1:500

Application Notes

Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: PKC alpha

Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. The protein encoded by this gene is one of the PKC family members. This kinase has been reported to play roles in many different cellular processes, such as cell adhesion, cell transformation, cell cycle checkpoint, and cell volume control. Knockout studies in mice suggest that this kinase may be a fundamental regulator of cardiac contractility and Ca(2+) handling in myocytes.

Long Name

Protein Kinase C alpha

Alternate Names

PKCA, PRKCA

Entrez Gene IDs

5578 (Human)

Gene Symbol

PRKCA

OMIM

176960 (Human)

UniProt

NP_002728 (Human)

Additional PKC alpha Products

Product Documents for PKC alpha Antibody (2F11) - Azide and BSA Free

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PKC alpha Antibody (2F11) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Diabetes

Intracellular Kinases

PDGF Family

Customer Reviews for PKC alpha Antibody (2F11) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review PKC alpha Antibody (2F11) - Azide and BSA Free and earn rewards!

Have you used PKC alpha Antibody (2F11) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PKC alpha Antibody (2F11) - Azide and BSA Free

Showing 1 - 1 的 1 FAQ Showing All

Q: We are looking into protein kinase C-alpha antibodies for immunohistochemistry on formalin fixed, paraffin embedded tissue. I see that you have many antibodies, including several monoclonals. I wanted to confirm with you that the following antibodies are specific for C-alpha. NB600-201=MC5 (an older paper suggested that this might react with alpha, beta, gamm), NB110-57356=Y124, NB110-57353=Y143. Also, if you have an comparator data or feedback regarding PKC-alpha antibodies for IHC on FFPE, that would be very helpful. We would like to pick 1 antibody that is easy to titer and robust, so that we can move forward with our studies.

A:
We have never heard any feedback that these cross-react with other PKC proteins. If you have seen data that MC5 may cross-react, then I would consider avoiding this antibody if you are concerned. The immunogens for NB110-57356 and NB110-57353 come from the N- and C-terminals, which is where the PKC proteins vary the most, so these are not expected to cross-react and we have had no feedback or testing data that suggests that they do. I would recommend NB110-57356, since it has been published with. You may want to review the published data to determine if it seems this antibody will suit your needs.