PKC alpha Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87269

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: CVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRST

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PKC alpha Antibody - BSA Free

Western Blot: PKC alpha Antibody [NBP1-87269]

Western Blot: PKC alpha Antibody [NBP1-87269]

Western Blot: PKC alpha Antibody [NBP1-87269] - Analysis using Anti-PRKCA antibody NBP1-87269 (A) shows similar pattern to independent antibody NBP1-87268 (B).
Immunocytochemistry/ Immunofluorescence: PKC alpha Antibody [NBP1-87269]

Immunocytochemistry/ Immunofluorescence: PKC alpha Antibody [NBP1-87269]

Immunocytochemistry/Immunofluorescence: PKC alpha Antibody [NBP1-87269] - Staining of human cell line U-2 OS shows localization to plasma membrane and cytosol.
Immunohistochemistry-Paraffin: PKC alpha Antibody [NBP1-87269]

Immunohistochemistry-Paraffin: PKC alpha Antibody [NBP1-87269]

Immunohistochemistry-Paraffin: PKC alpha Antibody [NBP1-87269] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.
Western Blot: PKC alpha Antibody [NBP1-87269]

Western Blot: PKC alpha Antibody [NBP1-87269]

Western Blot: PKC alpha Antibody [NBP1-87269] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Western Blot: PKC alpha Antibody [NBP1-87269]

Western Blot: PKC alpha Antibody [NBP1-87269]

Western Blot: PKC alpha Antibody [NBP1-87269] - Lane 1: Marker {kDA] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Huan Cerebral Cortex tissue.
Western Blot: PKC alpha Antibody [NBP1-87269]

Western Blot: PKC alpha Antibody [NBP1-87269]

Western Blot: PKC alpha Antibody [NBP1-87269] - Analysis in human cell lines A-549 and Caco-2 using anti-PRKCA antibody. Corresponding PRKCA RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.

Applications for PKC alpha Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PKC alpha

Protein Kinase C (PKC) is a large superfamily of serine/threonine kinases that mediate essential cellular signals required for activation, proliferation, differentiation and survival. There are at least ten PKC isotypes that are closely related in structure but that have distinct patterns of tissue distribution and function. The PKC isotypes can be subdivided into three classes based on primary structure and biochemical properties. These are: classical or conventional PKC isotypes (cPKC), novel PKC isotypes (nPKC) and atypical PKC isotypes (aPKC). All PKC isotypes share a characteristic equence motif C1 in addition to a serine/threonine-protein kinase domain. The cPKC isotypes include PKC

Long Name

Protein Kinase C alpha

Alternate Names

PKCA, PRKCA

Entrez Gene IDs

5578 (Human)

Gene Symbol

PRKCA

UniProt

Additional PKC alpha Products

Product Documents for PKC alpha Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PKC alpha Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for PKC alpha Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PKC alpha Antibody - BSA Free and earn rewards!

Have you used PKC alpha Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PKC alpha Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: We are looking into protein kinase C-alpha antibodies for immunohistochemistry on formalin fixed, paraffin embedded tissue. I see that you have many antibodies, including several monoclonals. I wanted to confirm with you that the following antibodies are specific for C-alpha. NB600-201=MC5 (an older paper suggested that this might react with alpha, beta, gamm), NB110-57356=Y124, NB110-57353=Y143. Also, if you have an comparator data or feedback regarding PKC-alpha antibodies for IHC on FFPE, that would be very helpful. We would like to pick 1 antibody that is easy to titer and robust, so that we can move forward with our studies.

    A:

    We have never heard any feedback that these cross-react with other PKC proteins. If you have seen data that MC5 may cross-react, then I would consider avoiding this antibody if you are concerned. The immunogens for NB110-57356 and NB110-57353 come from the N- and C-terminals, which is where the PKC proteins vary the most, so these are not expected to cross-react and we have had no feedback or testing data that suggests that they do. I would recommend NB110-57356, since it has been published with. You may want to review the published data to determine if it seems this antibody will suit your needs.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies