PRMT2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38197

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PRMT2 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human PRMT2 (NP_996845.1).

Sequence:
MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWGERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKVILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIESILYARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLAVKEFFSKPKYNHILKPEDCL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PRMT2 Antibody - BSA Free

PRMT2 Antibody

Western Blot: PRMT2 Antibody [NBP3-38197] -

Western Blot: PRMT2 Antibody [NBP3-38197] - Western blot analysis of lysates from mouse lung, using [KO Validated] PRMT2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 90s.
PRMT2 Antibody

Immunohistochemistry: PRMT2 Antibody [NBP3-38197] -

Immunohistochemistry: PRMT2 Antibody [NBP3-38197] - Immunohistochemistry analysis of paraffin-embedded Human liver damage using [KO Validated] PRMT2 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
PRMT2 Antibody

Immunocytochemistry/ Immunofluorescence: PRMT2 Antibody [NBP3-38197] -

Immunocytochemistry/ Immunofluorescence: PRMT2 Antibody [NBP3-38197] - Immunofluorescence analysis of HeLa cells using [KO Validated] PRMT2 Rabbit pAb.Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution.
PRMT2 Antibody

Western Blot: PRMT2 Antibody [NBP3-38197] -

Western Blot: PRMT2 Antibody [NBP3-38197] - Western Blot analysis of lysates from wild type (WT) and PRMT2 knockout (KO) 293T cells, using [KO Validated] PRMT2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.

Applications for PRMT2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:100

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PRMT2

PRMT2 is a member of the protein arginine N-methyltransferase family that has been shown to be both an androgen receptor (AR)-associated coactivator and an estrogen receptor. PRMT2 expression is upregulated in the lung under hypoxic conditions, and has been shown to inhibit cell activation and promote programmed cell death through a NF-kappaB-dependent mechanism.

Alternate Names

EC 2.1.1.-, EC 2.1.1.125, Histone-arginine N-methyltransferase PRMT2, HMT1, HMT1 (hnRNP methyltransferase, S. cerevisiae)-like 1, HMT1 hnRNP methyltransferase-like 1, HMT1 hnRNP methyltransferase-like 1 (S. cerevisiae), HRMT1L1PRMT2 beta, MGC111373, PRMT2 alpha, PRMT2 gamma, protein arginine methyltransferase 2, protein arginine N-methyltransferase 2

Gene Symbol

PRMT2

Additional PRMT2 Products

Product Documents for PRMT2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PRMT2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PRMT2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PRMT2 Antibody - BSA Free and earn rewards!

Have you used PRMT2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies