PSMB10/MECL1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88660

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: AGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PSMB10/MECL1 Antibody - BSA Free

Immunohistochemistry-Paraffin: PSMB10/MECL1 Antibody [NBP1-88660]

Immunohistochemistry-Paraffin: PSMB10/MECL1 Antibody [NBP1-88660]

Immunohistochemistry-Paraffin: PSMB10/MECL1 Antibody [NBP1-88660] - Analysis in human tonsil and skeletal muscle tissues using NBP1-88660 antibody. Corresponding PSMB10 RNA-seq data are presented for the same tissues.
Western Blot: PSMB10/MECL1 Antibody [NBP1-88660]

Western Blot: PSMB10/MECL1 Antibody [NBP1-88660]

Western Blot: PSMB10/MECL1 Antibody [NBP1-88660] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-450
Immunohistochemistry-Paraffin: PSMB10/MECL1 Antibody [NBP1-88660]

Immunohistochemistry-Paraffin: PSMB10/MECL1 Antibody [NBP1-88660]

Immunohistochemistry-Paraffin: PSMB10/MECL1 Antibody [NBP1-88660] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: PSMB10/MECL1 Antibody [NBP1-88660]

Immunohistochemistry-Paraffin: PSMB10/MECL1 Antibody [NBP1-88660]

Immunohistochemistry-Paraffin: PSMB10/MECL1 Antibody [NBP1-88660] - Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.
PSMB10/MECL1 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: PSMB10/MECL1 Antibody [NBP1-88660]

Immunocytochemistry/ Immunofluorescence: PSMB10/MECL1 Antibody [NBP1-88660]

Staining of human cell line A-431 shows localization to cytosol.

Applications for PSMB10/MECL1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PSMB10/MECL1

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. Proteolytic processing is required to generate a mature subunit. Expression of this gene is induced by gamma interferon, and this gene product replaces catalytic subunit 2 (proteasome beta 7 subunit) in the immunoproteasome.

Long Name

Proteasome (Prosome, Macropain) Subunit, beta Type, 10

Alternate Names

LMP10, MECl-1, MECL1, Proteasome subunit beta-2i

Gene Symbol

PSMB10

Additional PSMB10/MECL1 Products

Product Documents for PSMB10/MECL1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PSMB10/MECL1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for PSMB10/MECL1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PSMB10/MECL1 Antibody - BSA Free and earn rewards!

Have you used PSMB10/MECL1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...