RPL19 Antibody (3H4) - Azide and BSA Free
Novus Biologicals | Catalog # H00006143-M01
Loading...
Key Product Details
Validated by
Biological Validation
Species Reactivity
Validated:
Human, Mouse, Rat, Yeast
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG2a Lambda Clone # 3H4
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
RPL19 (NP_000972, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVHSRARCRKNTLARRKGRHMGIGKRKGTANARMPEKVTWMRRMR
Reactivity Notes
Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.
Specificity
RPL19 - ribosomal protein L19
Clonality
Monoclonal
Host
Mouse
Isotype
IgG2a Lambda
Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Scientific Data Images for RPL19 Antibody (3H4) - Azide and BSA Free
Western Blot: RPL19 Antibody (3H4) [H00006143-M01]
Western Blot: RPL19 Antibody (3H4) [H00006143-M01] - Analysis of RPL19 expression in transfected 293T cell line by RPL19 monoclonal antibody (M01), clone 3H4.Lane 1: RPL19 transfected lysate (Predicted MW: 23.5 KDa).Lane 2: Non-transfected lysate.Immunocytochemistry/ Immunofluorescence: RPL19 Antibody (3H4) [H00006143-M01]
Immunocytochemistry/Immunofluorescence: RPL19 Antibody (3H4) [H00006143-M01] - Immortalised untreated mouse dendritic cells stained with DAPI, Mettl27 and RPL19 in green. Acquisition in confocal imaging. RLP19 primary antibody coupled with Alexa488. ICC/IF image submitted by a verified customer review.Immunohistochemistry-Paraffin: RPL19 Antibody (3H4) [H00006143-M01]
Immunohistochemistry-Paraffin: RPL19 Antibody (3H4) [H00006143-M01] - Analysis of monoclonal antibody to RPL19 on formalin-fixed paraffin-embedded human small Intestine tissue. Antibody concentration 1 ~ 10 ug/ml.Western Blot: RPL19 Antibody (3H4) [H00006143-M01]
Western Blot: RPL19 Antibody (3H4) [H00006143-M01] - RPL19 monoclonal antibody (M01), clone 3H4 Analysis of RPL19 expression in HeLa.Western Blot: RPL19 Antibody (3H4) [H00006143-M01]
Western Blot: RPL19 Antibody (3H4) [H00006143-M01] - RPL19 monoclonal antibody (M01), clone 3H4. Analysis of RPL19 expression in PC-12.Western Blot: RPL19 Antibody (3H4) [H00006143-M01]
Western Blot: RPL19 Antibody (3H4) [H00006143-M01] - RPL19 monoclonal antibody (M01), clone 3H4. Analysis of RPL19 expression in Raw 264.7.Western Blot: RPL19 Antibody (3H4) [H00006143-M01]
Western Blot: RPL19 Antibody (3H4) [H00006143-M01] - RPL19 monoclonal antibody (M01), clone 3H4. Analysis of RPL19 expression in Jurkat.Western Blot: RPL19 Antibody (3H4) [H00006143-M01]
Western Blot: RPL19 Antibody (3H4) [H00006143-M01] - RPL19 monoclonal antibody (M01), clone 3H4. Analysis of RPL19 expression in NIH/3T3.Immunocytochemistry/ Immunofluorescence: RPL19 Antibody (3H4) [H00006143-M01]
Immunocytochemistry/Immunofluorescence: RPL19 Antibody (3H4) [H00006143-M01] - Analysis of monoclonal antibody to RPL19 on HeLa cell. Antibody concentration 10 ug/ml.ELISA: RPL19 Antibody (3H4) [H00006143-M01]
ELISA: RPL19 Antibody (3H4) [H00006143-M01] - Detection limit for recombinant GST tagged RPL19 is approximately 3ng/ml as a capture antibody.Applications for RPL19 Antibody (3H4) - Azide and BSA Free
Application
Recommended Usage
Western Blot
1:500
Reviewed Applications
Read 1 review rated 5 using H00006143-M01 in the following applications:
Formulation, Preparation, and Storage
Purification
IgG purified
Formulation
PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: RPL19
Alternate Names
DKFZp779D216, FLJ27452, MGC71997,60S ribosomal protein L19, ribosomal protein L19, ribosomal protein L19, cytosolic, N-terminus truncated
Entrez Gene IDs
6143 (Human)
Gene Symbol
RPL19
OMIM
180466 (Human)
UniProt
Additional RPL19 Products
Product Documents for RPL19 Antibody (3H4) - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for RPL19 Antibody (3H4) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for RPL19 Antibody (3H4) - Azide and BSA Free
Customer Reviews for RPL19 Antibody (3H4) - Azide and BSA Free (1)
5 out of 5
1 Customer Rating
Have you used RPL19 Antibody (3H4) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Customer Images
Showing
1
-
1 的
1 review
Showing All
Filter By:
-
Application: ImmunocytochemistrySample Tested: Immortalized mouse dendritic cellsSpecies: MouseVerified Customer | Posted 09/04/2020Immortalised untreated mouse dendritic cells stained with DAPI, Mettl27 and RPL19 in green;.Immunofluorescence. Acquisition in confocal imaging. RLP19 primary antibody coupled with Alexa488.
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...