S100A1 Antibody (1D5) - Azide and BSA Free

Novus Biologicals | Catalog # H00006271-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 1D5

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

S100A1 (NP_006262, 1 a.a. ~ 75 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEY

Localization

Cytoplasmic and Nuclear

Specificity

S100A1 - S100 calcium binding protein A1

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for S100A1 Antibody (1D5) - Azide and BSA Free

Western Blot: S100A1 Antibody (1D5) [H00006271-M01]

Western Blot: S100A1 Antibody (1D5) [H00006271-M01]

Western Blot: S100A1 Antibody (1D5) [H00006271-M01] - Analysis of S100A1 expression in transfected 293T cell line by S100A1 monoclonal antibody (M01), clone 1D5.Lane 1: S100A1 transfected lysate(10.5 KDa).Lane 2: Non-transfected lysate.
Sandwich ELISA: S100A1 Antibody (1D5) [H00006271-M01] - Detection limit for recombinant GST tagged S100A1 is approximately 0.3ng/ml as a capture antibody.

Applications for S100A1 Antibody (1D5) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: S100A1

S100 belongs to the family of calcium binding proteins such as calmodulin and troponin C. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. S100A is composed of an alpha and beta chain whereas S100B is composed of two beta chains. S100 protein may function in stimulation of Ca2+ induced Ca2+ release, inhibition of microtubule assembly, and inhibition of protein kinase C mediated phosphorylation. Reduced expression of this protein has been implicated in cardiomyopathies. Immunoreactive S100 protein localizes in the cytoplasm and nuclei of astrocytes, Schwann's cells, ependymomas and astrogliomas. Ganglion cells do not stain for S100 protein. S100 can be detected in almost all benign naevi and malignant melanocytic tumors of the skin, and in Langerhans cells in the skin.

Long Name

S100 Calcium Binding Protein A1

Alternate Names

protein S100-A1, S100 alpha, S100 calcium binding protein A1, S100 calcium-binding protein A1S100, S-100 protein alpha chain, S-100 protein subunit alpha, S100 protein, alpha polypeptide, S100A, S100-alpha

Entrez Gene IDs

6271 (Human)

Gene Symbol

S100A1

OMIM

176940 (Human)

UniProt

Additional S100A1 Products

Product Documents for S100A1 Antibody (1D5) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for S100A1 Antibody (1D5) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for S100A1 Antibody (1D5) - Azide and BSA Free

Customer Reviews for S100A1 Antibody (1D5) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review S100A1 Antibody (1D5) - Azide and BSA Free and earn rewards!

Have you used S100A1 Antibody (1D5) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...