S100A8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-90314

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKM

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for S100A8 Antibody - BSA Free

S100A8 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: S100A8 Antibody - BSA Free [NBP1-90314]

Immunocytochemistry/ Immunofluorescence: S100A8 Antibody - BSA Free [NBP1-90314]

Staining of human cell line HaCaT shows localization to intermediate filaments.
Immunohistochemistry-Paraffin: S100A8 Antibody [NBP1-90314]

Immunohistochemistry-Paraffin: S100A8 Antibody [NBP1-90314]

Immunohistochemistry-Paraffin: S100A8 Antibody [NBP1-90314] - Staining in human bone marrow and duodenum tissues using anti-S100A8 antibody. Corresponding S100A8 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: S100A8 Antibody [NBP1-90314]

Immunohistochemistry-Paraffin: S100A8 Antibody [NBP1-90314]

Immunohistochemistry-Paraffin: S100A8 Antibody [NBP1-90314] - Staining of human bone marrow shows high expression.
Immunohistochemistry-Paraffin: S100A8 Antibody [NBP1-90314]

Immunohistochemistry-Paraffin: S100A8 Antibody [NBP1-90314]

Immunohistochemistry-Paraffin: S100A8 Antibody [NBP1-90314] - Staining of human duodenum shows low expression as expected.
S100A8 Antibody - BSA Free Western Blot: S100A8 Antibody - BSA Free [NBP1-90314]

Western Blot: S100A8 Antibody - BSA Free [NBP1-90314]

Analysis in human cell line SK-BR-3.

Applications for S100A8 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: S100A8

MRP8 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis.

Long Name

S100 Calcium Binding Protein A8

Alternate Names

Calgranulin A, CFAG, MRP8

Gene Symbol

S100A8

Additional S100A8 Products

Product Documents for S100A8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for S100A8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for S100A8 Antibody - BSA Free

Customer Reviews for S100A8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review S100A8 Antibody - BSA Free and earn rewards!

Have you used S100A8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for S100A8 Antibody - BSA Free

Showing  1 - 22 FAQs Showing All
  • Q: Have any of your MRP8 antibodies been tested for use in neutralization, or blocking assays, on human samples?

    A:

    Unfortunately at this time we have not tested, or received customer feedback on our MMP8 antibodies for use in blocking or neutralizing assays. If you were planning on testing any of our MMP8 antibodies for neutralizing or blocking capabilities, we would recommend our Innovator’s Reward Program. Under the terms of this program we would be happy to provide a credit for a free vial in exchange for new data on this previously untested or reported application. Please submit this data in the form of an online review. Additional Innovators Reward Program information can be found using this link.

  • Q: We would like to stain paraffin embedded human intestinal tissue for Calprotectin. One question will be which cells express the majority of Calprotectin - invading neutrophils vs epithelium for example. The antibody list you provide is quite extensive. Which antibody would you recommend for our purpose? Which tissue would you recommend as positive control.

    A:

    Nine of our antibodies to Calprotectin have been validated for IHC-P with human tissue, and you can see all of these products. A number of our IHC images were generated using human spleen samples, and as such this may be a good choice of a positive control tissue. We do sell a human spleen slide product, which is suitable for IHC-P. Unfortunately I do not have an in-depth knowledge of Calprotectin, however the image shown for our antibody with catalogue number NBP1-02826 demonstrates clear staining of neutrophils. The following paper also suggests that the protein is abundant in neutrophils: PMID 11435495.

  • Q: Have any of your MRP8 antibodies been tested for use in neutralization, or blocking assays, on human samples?

    A:

    Unfortunately at this time we have not tested, or received customer feedback on our MMP8 antibodies for use in blocking or neutralizing assays. If you were planning on testing any of our MMP8 antibodies for neutralizing or blocking capabilities, we would recommend our Innovator’s Reward Program. Under the terms of this program we would be happy to provide a credit for a free vial in exchange for new data on this previously untested or reported application. Please submit this data in the form of an online review. Additional Innovators Reward Program information can be found using this link.

  • Q: We would like to stain paraffin embedded human intestinal tissue for Calprotectin. One question will be which cells express the majority of Calprotectin - invading neutrophils vs epithelium for example. The antibody list you provide is quite extensive. Which antibody would you recommend for our purpose? Which tissue would you recommend as positive control.

    A:

    Nine of our antibodies to Calprotectin have been validated for IHC-P with human tissue, and you can see all of these products. A number of our IHC images were generated using human spleen samples, and as such this may be a good choice of a positive control tissue. We do sell a human spleen slide product, which is suitable for IHC-P. Unfortunately I do not have an in-depth knowledge of Calprotectin, however the image shown for our antibody with catalogue number NBP1-02826 demonstrates clear staining of neutrophils. The following paper also suggests that the protein is abundant in neutrophils: PMID 11435495.

Showing  1 - 22 FAQs Showing All
View all FAQs for Antibodies
Loading...