SMURF2 Antibody (8O7F0)

Novus Biologicals | Catalog # NBP3-16105

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 8O7F0 expressed in HEK293
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 201-290 of human SMURF2 (Q9HAU4). PLSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSN

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

86 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SMURF2 Antibody (8O7F0)

Western Blot: SMURF2 Antibody (8O7F0) [NBP3-16105]

Western Blot: SMURF2 Antibody (8O7F0) [NBP3-16105]

Western Blot: SMURF2 Antibody (8O7F0) [NBP3-16105] - Western blot analysis of extracts of various cell lines, using SMURF2 Rabbit mAb (NBP3-16105) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 3min.
Immunohistochemistry-Paraffin: SMURF2 Antibody (8O7F0) [NBP3-16105]

Immunohistochemistry-Paraffin: SMURF2 Antibody (8O7F0) [NBP3-16105]

Immunohistochemistry-Paraffin: SMURF2 Antibody (8O7F0) [NBP3-16105] - Immunohistochemistry of paraffin-embedded human colon using SMURF2 Rabbit mAb (NBP3-16105) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunoprecipitation: SMURF2 Antibody (8O7F0) [NBP3-16105]

Immunoprecipitation: SMURF2 Antibody (8O7F0) [NBP3-16105]

Immunoprecipitation: SMURF2 Antibody (8O7F0) [NBP3-16105] - Immunoprecipitation analysis of 300ug extracts of Mouse lung cells using 3ug SMURF2 antibody (NBP3-16105). Western blot was performed from the immunoprecipitate using SMURF2 antibody (NBP3-16105) at a dilition of 1:1000.

Applications for SMURF2 Antibody (8O7F0)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL.

Immunohistochemistry

1:100 - 1:400

Immunohistochemistry-Paraffin

1:100 - 1:400

Immunoprecipitation

0.5μg-4μg antibody for 200μg-400μg extracts of whole cells

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SMURF2

Smad ubiquitination regulatory factor proteins (Smurf1 and Smurf2) are E3 ubiquitin ligase that belongs to the Hect family. Smurf proteins play an important role as regulators in TGF-beta pathway by ubiquitinating Smads and Smads associated proteins for proteasome degradation (1). Specifically, Smurf1 interacts with Smad1 and Smad5 for degradation, while Smurf2 ubiquitinates Smad1 and Smad2. Smads also functions to recruit Smurfs to various pathway components such as TGF-beta and SnoN. In particular, Smad7 acts as an adaptor protein between Smurfs and TGF-Beta receptors, allowing the receptors to be marked by Smurfs for degradation (2). Smurf2 interacts with all members of Smad family except for Smad4 and it is expressed various tissues and cell lines, such as placenta and ovarian cancer cell lines. Smurf2 has been implicated in the tumor formation and diseases progression (3).

Long Name

SMAD Ubiquitination Regulatory Factor 2

Alternate Names

DKFZp686F0270, E3 ubiquitin ligase SMURF2, E3 ubiquitin-protein ligase SMURF2, EC 6.3.2, EC 6.3.2.-, hSMURF2, MGC138150, SMAD specific E3 ubiquitin protein ligase 2, SMAD ubiquitination regulatory factor 2, SMAD-specific E3 ubiquitin-protein ligase 2

Gene Symbol

SMURF2

Additional SMURF2 Products

Product Documents for SMURF2 Antibody (8O7F0)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SMURF2 Antibody (8O7F0)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SMURF2 Antibody (8O7F0)

There are currently no reviews for this product. Be the first to review SMURF2 Antibody (8O7F0) and earn rewards!

Have you used SMURF2 Antibody (8O7F0)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

TGF-beta Signaling Pathways TGF-beta Signaling Pathway Thumbnail