SPINK1 Antibody (4D4) - Azide and BSA Free

Novus Biologicals | Catalog # H00006690-M01

Novus Biologicals
Loading...

Key Product Details

Validated by

Biological Validation

Species Reactivity

Validated:

Human, Mouse

Cited:

Human, Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Cited:

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Immunocytochemistry/ Immunofluorescence, IF/IHC

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 4D4

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

SPINK1 (AAH25790, 24 a.a. ~ 79 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 32929152)

Localization

Secreted

Specificity

SPINK1 - serine protease inhibitor, Kazal type 1

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for SPINK1 Antibody (4D4) - Azide and BSA Free

Western Blot: SPINK1 Antibody (4D4) [H00006690-M01]

Western Blot: SPINK1 Antibody (4D4) [H00006690-M01]

Western Blot: SPINK1 Antibody (4D4) [H00006690-M01] - Detection against Immunogen (31.9 kDa). Antibody reactive against recombinant protein.
Immunohistochemistry-Paraffin: SPINK1 Antibody (4D4) [H00006690-M01]

Immunohistochemistry-Paraffin: SPINK1 Antibody (4D4) [H00006690-M01]

Immunohistochemistry-Paraffin: SPINK1 Antibody (4D4) [H00006690-M01] - Analysis of SPINK1 antibody (4D4) on mouse pancreas tissue. Antibody concentration 1 ug/ml. Image from verified customer review.
Western Blot: SPINK1 Antibody (4D4) [H00006690-M01]

Western Blot: SPINK1 Antibody (4D4) [H00006690-M01]

Western Blot: SPINK1 Antibody (4D4) [H00006690-M01] - SPINK1 monoclonal antibody (M01), clone 4D4. Analysis of SPINK1 expression in human pancreas.
Immunohistochemistry-Paraffin: SPINK1 Antibody (4D4) [H00006690-M01]

Immunohistochemistry-Paraffin: SPINK1 Antibody (4D4) [H00006690-M01]

Immunohistochemistry-Paraffin: SPINK1 Antibody (4D4) [H00006690-M01] - Analysis of monoclonal antibody to SPINK1 on formalin-fixed paraffin-embedded human pancreas. Antibody concentration 1 ug/ml.
Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01]

Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01]

SPINK1-Antibody-4D4-Immunohistochemistry-H00006690-M01-img0012.jpg
Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01]

Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01]

SPINK1-Antibody-4D4-Immunohistochemistry-H00006690-M01-img0013.jpg
Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01]

Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01]

SPINK1-Antibody-4D4-Immunohistochemistry-H00006690-M01-img0014.jpg
Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01]

Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01]

SPINK1-Antibody-4D4-Immunohistochemistry-H00006690-M01-img0015.jpg
Immunoprecipitation: SPINK1 Antibody (4D4) [H00006690-M01]

Immunoprecipitation: SPINK1 Antibody (4D4) [H00006690-M01]

Immunoprecipitation: SPINK1 Antibody (4D4) [H00006690-M01] - Analysis of SPINK1 transfected lysate using anti-SPINK1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SPINK1 MaxPab rabbit polyclonal antibody.
ELISA: SPINK1 Antibody (4D4) [H00006690-M01]

ELISA: SPINK1 Antibody (4D4) [H00006690-M01]

ELISA: SPINK1 Antibody (4D4) [H00006690-M01] - Detection limit for recombinant GST tagged SPINK1 is 0.03 ng/ml as a capture antibody.
SPINK1 Antibody (4D4)

Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] -

Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - ADT induced SPINK1 upregulation associates with NE-phenotype in mice & NEPC patients.a Box plots depicting relative expression of SPINK1, SYP, CHGA, TUBB3, & VIM transcripts (read counts) in VCaP tumors implanted orthotopically in orchiectomized mice & subjected to vehicle (n = 4) or anti-androgens [enzalutamide (n = 4) or ARN-509 (n = 4)] treatment for 4 weeks (GSE95413). b Representative images of immunohistochemical staining for the same markers shown in a using VCaP xenograft tumors as described in a. Scale bar represents 100 μm. c Box plots depicting quantification of the immunohistochemical staining in VCaP xenografts for the markers shown in b. d Representative images for immunohistochemical staining of SPINK1, SYP, CHGA, & TUBB3 in 22RV1 xenograft tumors excised from orchiectomized mice treated with enzalutamide (20 mg/kg body weight) or vehicle control (n = 5 each). Intact group represents non-castrated control mice (n = 5). Scale bar represents 50 μm. e Box plots depicting quantification of the immunohistochemical staining in 22RV1 xenografts for the markers shown in d. f Representative images showing H&E staining (×200 magnification) & immunostaining (×200 magnification) for AR, synaptophysin, & SPINK1 in tumor specimens obtained from NEPC patients’, namely WCM12, WCM155 (an organoid), & WCM677. Scale bar represents 100 µm. Data are presented as box-and-whisker plots with median, where the box extends from 25th–75th percentile, & whiskers ranges from minimum & maximum values. For panels a, c, e one-way ANOVA, Dunnett’s multiple-comparisons test was applied. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31959826), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
SPINK1 Antibody (4D4)

Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] -

Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - SPINK1 is negatively correlated with AR in PCa patients.a Heatmap depicting AR & SPINK1 expression in TCGA-PRAD cohort (n = 180). Shades of yellow & blue represents expression values in log2 (RPM+1). b Representative micrographs depicting PCa tissue microarray (TMA) cores (n = 237), immunostained for SPINK1 & AR expression by immunohistochemistry (IHC). Top panel shows representative IHC for SPINK1 in SPINK1-negative (SPINK1−) & SPINK1-positive (SPINK1+) patients. Bottom panel represents IHC for AR expression in the tumor core from same patients. Scale bar represents 500 µm & 100 µm for the entire core & the inset images, respectively. c Bar plot showing percentage of IHC scoring for AR in the SPINK1+ & SPINK1− patients’ specimens. P-value for the Chi-Square test is indicated. d Contingency table for the AR & SPINK1 status. Patients showing high or medium expression of AR were grouped as AR-(Hi/Med), while patients with low or null AR expression were indicated as AR-(Low/Neg). P-value for Fisher’s exact test is indicated. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31959826), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
SPINK1 Antibody (4D4)

Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] -

Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - Spatial gene expression heterogeneity within the 1.2 cancer tissue sample. a Factor activity maps for selected factors corresponding to epithelial, stromal, cancerous, PIN, or inflamed regions. Remaining factors’ activity maps in Supplementary Figure 2 & Supplementary Data 1. b Annotated brightfield image of H&E-stained tissue section. c Heatmap of the 20 most variable genes between cancer, PIN & normal gland regions, using spot sets from Supplementary Fig. 4b. Centered rlog: difference of rlog (variance-stabilized transform of ST expression data) & gene-wise mean rlog. Arrows highlight genes of interest validated by immunohistochemistry (IHC). d First two principal components of spot sets from c separate cancer, PIN & normal regions. e Array dot plots for SPINK1 & NPY. Circle size in array dot plots indicates normalized ST counts. f IHC staining for SPINK1 & NPY of an adjacent section on the ST array. Nuclei are stained with DAPI (blue). Scale bar indicates 1 mm Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/29925878), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
SPINK1 Antibody (4D4)

Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] -

Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - ADT induced SPINK1 upregulation associates with NE-phenotype in mice & NEPC patients.a Box plots depicting relative expression of SPINK1, SYP, CHGA, TUBB3, & VIM transcripts (read counts) in VCaP tumors implanted orthotopically in orchiectomized mice & subjected to vehicle (n = 4) or anti-androgens [enzalutamide (n = 4) or ARN-509 (n = 4)] treatment for 4 weeks (GSE95413). b Representative images of immunohistochemical staining for the same markers shown in a using VCaP xenograft tumors as described in a. Scale bar represents 100 μm. c Box plots depicting quantification of the immunohistochemical staining in VCaP xenografts for the markers shown in b. d Representative images for immunohistochemical staining of SPINK1, SYP, CHGA, & TUBB3 in 22RV1 xenograft tumors excised from orchiectomized mice treated with enzalutamide (20 mg/kg body weight) or vehicle control (n = 5 each). Intact group represents non-castrated control mice (n = 5). Scale bar represents 50 μm. e Box plots depicting quantification of the immunohistochemical staining in 22RV1 xenografts for the markers shown in d. f Representative images showing H&E staining (×200 magnification) & immunostaining (×200 magnification) for AR, synaptophysin, & SPINK1 in tumor specimens obtained from NEPC patients’, namely WCM12, WCM155 (an organoid), & WCM677. Scale bar represents 100 µm. Data are presented as box-and-whisker plots with median, where the box extends from 25th–75th percentile, & whiskers ranges from minimum & maximum values. For panels a, c, e one-way ANOVA, Dunnett’s multiple-comparisons test was applied. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31959826), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
SPINK1 Antibody (4D4)

Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] -

Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - ADT induced SPINK1 upregulation associates with NE-phenotype in mice & NEPC patients.a Box plots depicting relative expression of SPINK1, SYP, CHGA, TUBB3, & VIM transcripts (read counts) in VCaP tumors implanted orthotopically in orchiectomized mice & subjected to vehicle (n = 4) or anti-androgens [enzalutamide (n = 4) or ARN-509 (n = 4)] treatment for 4 weeks (GSE95413). b Representative images of immunohistochemical staining for the same markers shown in a using VCaP xenograft tumors as described in a. Scale bar represents 100 μm. c Box plots depicting quantification of the immunohistochemical staining in VCaP xenografts for the markers shown in b. d Representative images for immunohistochemical staining of SPINK1, SYP, CHGA, & TUBB3 in 22RV1 xenograft tumors excised from orchiectomized mice treated with enzalutamide (20 mg/kg body weight) or vehicle control (n = 5 each). Intact group represents non-castrated control mice (n = 5). Scale bar represents 50 μm. e Box plots depicting quantification of the immunohistochemical staining in 22RV1 xenografts for the markers shown in d. f Representative images showing H&E staining (×200 magnification) & immunostaining (×200 magnification) for AR, synaptophysin, & SPINK1 in tumor specimens obtained from NEPC patients’, namely WCM12, WCM155 (an organoid), & WCM677. Scale bar represents 100 µm. Data are presented as box-and-whisker plots with median, where the box extends from 25th–75th percentile, & whiskers ranges from minimum & maximum values. For panels a, c, e one-way ANOVA, Dunnett’s multiple-comparisons test was applied. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31959826), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for SPINK1 Antibody (4D4) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry-Frozen

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry-Paraffin

Optimal dilutions of this antibody should be experimentally determined.

Immunoprecipitation

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.

Reviewed Applications

Read 1 review rated 5 using H00006690-M01 in the following applications:

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: SPINK1

The protein encoded by this gene is a trypsin inhibitor, which is secreted from pancreatic acinar cells into pancreatic juice. It is thought to function in the prevention of trypsin-catalyzed premature activation of zymogens within the pancreas and the pancreatic duct. Mutations in this gene are associated with hereditary pancreatitis and tropical calcific pancreatitis.

Long Name

Serine Peptidase Inhibitor, Kazal Type 1

Alternate Names

PCTT, PSTI, Spink3, TATI

Entrez Gene IDs

6690 (Human)

Gene Symbol

SPINK1

OMIM

167790 (Human)

Additional SPINK1 Products

Product Documents for SPINK1 Antibody (4D4) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SPINK1 Antibody (4D4) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for SPINK1 Antibody (4D4) - Azide and BSA Free

Customer Reviews for SPINK1 Antibody (4D4) - Azide and BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used SPINK1 Antibody (4D4) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 11 review Showing All
Filter By:
  • SPINK1 Antibody (4D4)
    Name: Anonymous
    Application: Immunohistochemistry-Paraffin
    Sample Tested: Pancreas tissue
    Species: Mouse
    Verified Customer | Posted 02/10/2022
    Pancreas tissue
    Antibody concentration 1 ug/ml
    SPINK1 Antibody (4D4) - Azide and BSA Free H00006690-M01

There are no reviews that match your criteria.

Showing  1 - 11 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...