TCF-2/HNF-1 beta Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-89680
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Validated:
Human
Cited:
Human, Mouse
Predicted:
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western
Cited:
Immunocytochemistry/ Immunofluorescence, Chemotaxis, IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KEVLVQALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQH
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for TCF-2/HNF-1 beta Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: TCF-2/HNF-1 beta Antibody - BSA Free [NBP1-89680]
Staining of human cell line CACO-2 shows localization to nucleoplasm.Immunohistochemistry-Paraffin: TCF-2/HNF-1 beta Antibody [NBP1-89680]
Immunohistochemistry-Paraffin: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Nuclear expression of HNF1B (green) in a subset of PDX1 expressing cells (blue) in human pancreas. Image submitted by a verified customer review.Immunohistochemistry-Paraffin: TCF-2/HNF-1 beta Antibody [NBP1-89680]
Immunohistochemistry-Paraffin: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Staining of human kidney shows moderate to strong nuclear positivity in renal tubules.Immunohistochemistry-Paraffin: TCF-2/HNF-1 beta Antibody [NBP1-89680]
Immunohistochemistry-Paraffin: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Staining of human rectum shows strong nuclear positivity in glandular cells.Immunohistochemistry-Paraffin: TCF-2/HNF-1 beta Antibody [NBP1-89680]
Immunohistochemistry-Paraffin: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Staining of human lymph node shows no positivity in lymphoid cells as expected.Immunohistochemistry-Paraffin: TCF-2/HNF-1 beta Antibody - BSA Free [NBP1-89680]
Staining of human rectum shows strong nuclear positivity in glandular cells.Western Blot: TCF-2/HNF-1 beta Antibody - BSA Free [NBP1-89680]
Analysis in human kidney tissue.Simple Western: TCF-2/HNF-1 beta Antibody [NBP1-89680]
Simple Western: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Electropherogram image(s) of corresponding Simple Western lane view. TCF-2/HNF-1 beta antibody was used at 1:30 dilution on A549 lysate(s).Simple Western: TCF-2/HNF-1 beta Antibody [NBP1-89680]
Simple Western: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Simple Western lane view shows a specific band for HNF1B in 0.2 mg/ml of A549 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.Applications for TCF-2/HNF-1 beta Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:1000 - 1:2500
Immunohistochemistry-Paraffin
1:1000 - 1:2500
Simple Western
1:30
Western Blot
0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in A549, separated by Size, antibody dilution of 1:30, apparent MW was 66 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in A549, separated by Size, antibody dilution of 1:30, apparent MW was 66 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
Reviewed Applications
Read 1 review rated 5 using NBP1-89680 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: TCF-2/HNF-1 beta
Long Name
Transcription Factor 2
Alternate Names
HNF-1 beta, HNF1B, HNF2, LF-B3, MODY5, TCF2, VHNF1
Entrez Gene IDs
6928 (Human)
Gene Symbol
HNF1B
UniProt
Additional TCF-2/HNF-1 beta Products
Product Documents for TCF-2/HNF-1 beta Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for TCF-2/HNF-1 beta Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for TCF-2/HNF-1 beta Antibody - BSA Free
Customer Reviews for TCF-2/HNF-1 beta Antibody - BSA Free (1)
5 out of 5
1 Customer Rating
Have you used TCF-2/HNF-1 beta Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Customer Images
Showing
1
-
1 的
1 review
Showing All
Filter By:
-
Application: Immunohistochemistry-ParaffinSample Tested: Human fetal pancreasSpecies: HumanVerified Customer | Posted 09/25/2014Nuclear expression of HNF1B (green) in a subset of PDX1 expressing cells (grey) in developing human pancreas.
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...