TGF-beta 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80289

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Porcine

Cited:

Mouse, Rat, Porcine

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Imaging Mass Cytometry

Cited:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the middle region of mouse TGFB1. Peptide sequence DTPEWLSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNKLHVEINGIS. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Porcine reactivity reported in scientific literature (PMID: 23616520).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TGF-beta 1 Antibody - BSA Free

Western Blot: TGF-beta 1 Antibody [NBP1-80289]

Western Blot: TGF-beta 1 Antibody [NBP1-80289]

Western Blot: TGF-beta 1 Antibody [NBP1-80289] - Sample Tissue: Human Fetal Heart. Antibody Dilution: 1.0ug/ml
Immunocytochemistry/ Immunofluorescence: TGF-beta 1 Antibody [NBP1-80289]

Immunocytochemistry/ Immunofluorescence: TGF-beta 1 Antibody [NBP1-80289]

Immunocytochemistry/Immunofluorescence: TGF-beta 1 Antibody [NBP1-80289] - Mouse kidney (red fluorescence). Nuclei were stained with DAPI (blue fluorescence). Working dilutions: 5-10 ug/ml
Immunohistochemistry-Paraffin: TGF-beta 1 Antibody [NBP1-80289]

Immunohistochemistry-Paraffin: TGF-beta 1 Antibody [NBP1-80289]

Immunohistochemistry-Paraffin: TGF-beta 1 Antibody [NBP1-80289] - Human Appendix FFPE tissue section stained with TGF-beta 1 antibody. IHC-P image submitted by a verified customer review.
Western Blot: TGF-beta 1 Antibody [NBP1-80289]

Western Blot: TGF-beta 1 Antibody [NBP1-80289]

Western Blot: TGF-beta 1 Antibody [NBP1-80289] - Antibody Titration: 0.2-1 ug/ml or 1:5000 to 1:1000 Dilution. SP2/0 cell lysate.
Western Blot: TGF-beta 1 Antibody [NBP1-80289]

Western Blot: TGF-beta 1 Antibody [NBP1-80289]

Western Blot: TGF-beta 1 Antibody [NBP1-80289] - Sample Tissue: Mouse Spleen. Antibody Dilution: 1ug/ml
Western Blot: TGF-beta 1 Antibody [NBP1-80289]

Western Blot: TGF-beta 1 Antibody [NBP1-80289]

Western Blot: TGF-beta 1 Antibody [NBP1-80289] - Sample Tissue: Mouse Pancreas. Antibody Dilution: 1ug/ml
Immunohistochemistry-Paraffin: TGF-beta 1 Antibody [NBP1-80289]

Immunohistochemistry-Paraffin: TGF-beta 1 Antibody [NBP1-80289]

Immunohistochemistry-Paraffin: TGF-beta 1 Antibody [NBP1-80289] - Human Spleen Tissue, 5 ug/ml.
Immunohistochemistry-Paraffin: TGF-beta 1 Antibody [NBP1-80289]

Immunohistochemistry-Paraffin: TGF-beta 1 Antibody [NBP1-80289]

Immunohistochemistry-Paraffin: TGF-beta 1 Antibody [NBP1-80289] - Human prostate cancer tissue was detected using RP/AEC red color stain. Working dilutions: 5-10 ug/ml.
Imaging Mass Cytometry: TGF-beta 1 Antibody [NBP1-80289]

Imaging Mass Cytometry: TGF-beta 1 Antibody [NBP1-80289]

Imaging Mass Cytometry: TGF-beta 1 Antibody [NBP1-80289] - Human bone marrow FFPE tissue sections. DNA in blue, TGF-beta 1 antibody staining in white. IMC image submitted by a verified customer review.
TGF-beta 1 Antibody

Immunocytochemistry/Immunofluorescence: Rabbit Polyclonal TGF-beta 1 Antibody [NBP1-80289]

Immunocytochemistry/Immunofluorescence: Rabbit Polyclonal TGF-beta 1 Antibody [NBP1-80289] - Mice hepatocytes stained with TGF-beta 1 Antibody. Image from a verified customer review.
TGF-beta 1 Antibody - BSA Free

Western Blot: TGF-beta 1 Antibody - BSA Free [NBP1-80289] -

Effects of MICT and HIIT on the liver. (A) Representative histological images stained with Picro Sirius Red at 10× and 20× for (A) MICT group and (B) HIIT group. Arrows indicate collagen accumulation points. (C) Collagen 1 and (D) transforming growth factor (TGF) beta 1 and their representative blots below its respective graph with its membrane stained with Ponceau S used as loading control. Data are presented as mean +/- SD. *: p < 0.05. Each dot represents a participant. Image collected and cropped by CiteAb from the following open publication (https://www.mdpi.com/2077-0383/13/11/3273), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for TGF-beta 1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

5-10 ug/ml

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

5-10 ug/ml

Western Blot

1.0 ug/ml
Application Notes
This TGF-beta 1 Antibody is validated for Imaging Mass Cytometry from a verified customer review.

Reviewed Applications

Read 3 reviews rated 4.7 using NBP1-80289 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TGF-beta 1

TGF-beta-1 is a multifunctional cytokine that belongs to a superfamily of structurally related regulatory proteins, which includes three mammalian TGF-beta isoforms (TGF-beta-1, -beta-2, and -beta-3), activin/inhibins and bone morphogenetic proteins. The most abundant isoform, TGF-beta-1, is a 25kDa homodimer composed of two 12.5kDa subunits joined by disulfide bonds. TGF-beta-1 is a highly conserved molecule - the amino acid sequence between human and mouse differ only by one residue. Although originally defined by its ability to cause anchorage independent cell growth and changes in cell morphology of rat fibroblasts, subsequent research has revealed that TGF-beta is actually a major growth inhibitor for most cell types. It is produced by a wide variety of cell and tissue types during all stages of cell differentiation. TGF-beta-1 sources include platelets, bone and soft tissues such as placenta and kidneys.

Long Name

Transforming Growth Factor beta 1

Alternate Names

TGF beta1, TGFB, TGFB1, TGFbeta 1

Gene Symbol

TGFB1

Additional TGF-beta 1 Products

Product Documents for TGF-beta 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TGF-beta 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for TGF-beta 1 Antibody - BSA Free

Customer Reviews for TGF-beta 1 Antibody - BSA Free (3)

4.7 out of 5
3 Customer Ratings
5 Stars
67%
4 Stars
33%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used TGF-beta 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 33 reviews Showing All
Filter By:
  • TGF-beta 1 Antibody
    Name: Armen Petrosyan
    Application: Immunofluorescence
    Sample Tested: Primary mouse hepatocytes
    Species: Mouse
    Verified Customer | Posted 11/19/2024
    Mice hepatocytes stained with NBP1-80289
    TGF-beta 1 Antibody - BSA Free NBP1-80289
  • TGF-beta 1 Antibody
    Name: Michela Colombo
    Application: Imaging Mass Cytometry
    Sample Tested: bone marrow
    Species: Human
    Verified Customer | Posted 11/12/2021
    IMC staining of BM FFPE samples DNA- blue TGFb-white
    TGF-beta 1 Antibody - BSA Free NBP1-80289
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.
  • Name: Anonymous
    Application: Immunohistochemistry-Paraffin
    Sample Tested: Appendix FFPE section
    Species: Human
    Verified Customer | Posted 09/16/2016
    TGFb1 human appendix
    TGF-beta 1 Antibody - BSA Free NBP1-80289

There are no reviews that match your criteria.

Showing  1 - 33 reviews Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TGF-beta 1 Antibody - BSA Free

Showing  1 - 22 FAQs Showing All
  • Q: Does TGF-beta 1 react across multiple species?

    A: TGF-beta 1 is a highly conserved molecule varying by just a few amino acids  between most species, and thus it is extremely likely to react across species. For example, human TGF-beta 1 is active on mouse cells and vice versa.

  • Q: Will Recombinant Human TGF-beta 1 support the maintenance of either human or non-human cultured cells?

    A: TGF-beta 1 performs multiple cellular functions, including cell growth, proliferation, differentiation and apoptosis.  It would be necessary to determine the specific conditions for cell growth/proliferation for the cells being cultured.

  • Q: Does TGF-beta 1 react across multiple species?

    A: TGF-beta 1 is a highly conserved molecule varying by just a few amino acids  between most species, and thus it is extremely likely to react across species. For example, human TGF-beta 1 is active on mouse cells and vice versa.

  • Q: Will Recombinant Human TGF-beta 1 support the maintenance of either human or non-human cultured cells?

    A: TGF-beta 1 performs multiple cellular functions, including cell growth, proliferation, differentiation and apoptosis.  It would be necessary to determine the specific conditions for cell growth/proliferation for the cells being cultured.

Showing  1 - 22 FAQs Showing All
View all FAQs for Antibodies