Transglutaminase 1/TGM1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-34062
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry-Paraffin, Western Blot
Cited:
Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MMDGPRSDVGRWGGNPLQPPTTPSPEPEPEPDGRSRRGGGRSFWARCCGCCSCRNAADDDWGPEPSDSRGRGSSSGTRRPGSRGSDSRRPVSRGSGVNAA
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Transglutaminase 1/TGM1 Antibody - BSA Free
Western Blot: Transglutaminase 1/TGM1 Antibody [NBP2-34062]
Western Blot: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Analysis in human tonsil tissue.Western Blot: Transglutaminase 1/TGM1 Antibody - BSA Free [NBP2-34062] -
ATF4 and CHOP are required for efficient TPA-induced lytic EBV reactivation and differentiation in WT EBV-infected NOKs.WT EBV-infected NOKs cells were transfected with control siRNA or siRNAs against ATF4 (A and C) or CHOP (B and D) as indicated, and then treated with TPA for 24 hours starting one day after siRNA transfection. (A and B) Immunoblot analyses were performed to examine the effect of ATF4 and CHOP knock-down on lytic EBV proteins BZLF1, BRLF1, BMRF1 and p18 VCA as indicated. (C and D) Immunoblot analyses were performed to examine the effect of ATF4 and CHOP knock-down on TPA-induced differentiation markers BLIMP1, TGM1, and SPRR1A as indicated. Tubulin served as a loading control. The cellular extracts used in (A) and (C) or (B) and (D) were the same. The same ATF4 and Tubulin blots were used in (A) and (C), and the same CHOP and Tubulin blots were used for (B) and (D). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/39951426), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: Transglutaminase 1/TGM1 Antibody - BSA Free [NBP2-34062] -
GCN2 is required for TPA-induced lytic EBV reactivation and differentiation in WT EBV-infected NOKs.WT EBV-infected NOKs cells were transfected with control siRNA or siRNAs against GCN2 as indicated, and then treated with TPA for 24 hours starting one day after siRNA transfection. (A) Immunoblot analysis was performed to examine the effect of GCN2 knock-down on proteins involved in the ISR pathway (including p-GCN2, GCN2, p-eIF2 alpha, eiF2 alpha, ATF4, and CHOP) and EBV lytic proteins (BZLF1, BRLF1, BMRF1, and p18 VCA). (B) Immunoblot analyses were performed to examine the effect of GCN2 knock-down on differentiation-induced cellular proteins Involucrin, BLIMP1, and TGM1. Tubulin served as a loading control for both panels. The same extracts were used for each panel, and the same GCN2, p-GCN2, and Tubulin blots were used for both panels. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/39951426), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: Transglutaminase 1/TGM1 Antibody - BSA Free [NBP2-34062] -
PERK is also required for efficient TPA-induced lytic EBV reactivation and differentiation in WT EBV-infected NOKs.WT EBV-infected NOKs cells were transfected with control siRNA or siRNAs against PERK as indicated, and then treated with TPA for 24 hours starting one day after siRNA transfection. (A) Immunoblot analyses were performed to examine the effect of PERK knock-down on EBV lytic proteins BZLF1, BRLF1, and BMRF1. (B) Immunoblot analyses were performed to examine the effect of PERK knock-down on differentiation-induced cellular proteins BLIMP1, TGM1, Involucrin and SPRR1A. Tubulin served as a loading control for both panels. The same extracts were used for both panels, and the same PERK and Tubulin blots were used for both panels. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/39951426), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: Transglutaminase 1/TGM1 Antibody - BSA Free [NBP2-34062] -
ATF4 and CHOP are required for efficient TPA-induced lytic EBV reactivation and differentiation in WT EBV-infected NOKs.WT EBV-infected NOKs cells were transfected with control siRNA or siRNAs against ATF4 (A and C) or CHOP (B and D) as indicated, and then treated with TPA for 24 hours starting one day after siRNA transfection. (A and B) Immunoblot analyses were performed to examine the effect of ATF4 and CHOP knock-down on lytic EBV proteins BZLF1, BRLF1, BMRF1 and p18 VCA as indicated. (C and D) Immunoblot analyses were performed to examine the effect of ATF4 and CHOP knock-down on TPA-induced differentiation markers BLIMP1, TGM1, and SPRR1A as indicated. Tubulin served as a loading control. The cellular extracts used in (A) and (C) or (B) and (D) were the same. The same ATF4 and Tubulin blots were used in (A) and (C), and the same CHOP and Tubulin blots were used for (B) and (D). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/39951426), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062]
Staining of human skin shows moderate membranous positivity in squamous epithelial cells.Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062]
Staining of human tonsil shows moderate membranous positivity in squamous epithelial cells.Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062]
Staining of human liver shows no positivity in hepatocytes as expected.Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062]
Staining of human colon shows no positivity in glandular cells as expected.Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062]
Staining of human esophagus shows moderate membranous positivity in squamous epithelial cells.Applications for Transglutaminase 1/TGM1 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry-Paraffin
1:2500 - 1:5000
Western Blot
0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Transglutaminase 1/TGM1
Additional Transglutaminase 1/TGM1 Products
Product Documents for Transglutaminase 1/TGM1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Transglutaminase 1/TGM1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for Transglutaminase 1/TGM1 Antibody - BSA Free
Customer Reviews for Transglutaminase 1/TGM1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Transglutaminase 1/TGM1 Antibody - BSA Free and earn rewards!
Have you used Transglutaminase 1/TGM1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...