Transglutaminase 2/TGM2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86952

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFSVVTGPAPSQEAGTK

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Transglutaminase 2/TGM2 Antibody - BSA Free

Immunohistochemistry-Paraffin: Transglutaminase 2/TGM2 Antibody [NBP1-86952]

Immunohistochemistry-Paraffin: Transglutaminase 2/TGM2 Antibody [NBP1-86952]

Immunohistochemistry-Paraffin: Transglutaminase 2/TGM2 Antibody [NBP1-86952] - Analysis in human placenta and testis tissues. Corresponding TGM2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Transglutaminase 2/TGM2 Antibody [NBP1-86952]

Immunohistochemistry-Paraffin: Transglutaminase 2/TGM2 Antibody [NBP1-86952]

Immunohistochemistry-Paraffin: Transglutaminase 2/TGM2 Antibody [NBP1-86952] - Staining of human endometrium, fallopian tube, placenta and testis using Anti-TGM2 antibody NBP1-86952 (A) shows similar protein distribution across tissues to independent antibody NBP1-86951 (B).
Immunohistochemistry-Paraffin: Transglutaminase 2/TGM2 Antibody [NBP1-86952]

Immunohistochemistry-Paraffin: Transglutaminase 2/TGM2 Antibody [NBP1-86952]

Immunohistochemistry-Paraffin: Transglutaminase 2/TGM2 Antibody [NBP1-86952] - Staining of human Fallopian tube shows strong cytoplasmic positivity in stromal cells.
Immunohistochemistry-Paraffin: Transglutaminase 2/TGM2 Antibody [NBP1-86952]

Immunohistochemistry-Paraffin: Transglutaminase 2/TGM2 Antibody [NBP1-86952]

Immunohistochemistry-Paraffin: Transglutaminase 2/TGM2 Antibody [NBP1-86952] - Staining of human endometrium shows moderate cytoplasmic positivity in stromal cells.
Immunohistochemistry-Paraffin: Transglutaminase 2/TGM2 Antibody [NBP1-86952]

Immunohistochemistry-Paraffin: Transglutaminase 2/TGM2 Antibody [NBP1-86952]

Immunohistochemistry-Paraffin: Transglutaminase 2/TGM2 Antibody [NBP1-86952] - Staining of human testis shows weak cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: Transglutaminase 2/TGM2 Antibody [NBP1-86952]

Immunohistochemistry-Paraffin: Transglutaminase 2/TGM2 Antibody [NBP1-86952]

Immunohistochemistry-Paraffin: Transglutaminase 2/TGM2 Antibody [NBP1-86952] - Staining of human placenta shows very strong cytoplasmic positivity in trophoblastic cells.
Western Blot: Transglutaminase 2/TGM2 Antibody [NBP1-86952]

Western Blot: Transglutaminase 2/TGM2 Antibody [NBP1-86952]

Western Blot: Transglutaminase 2/TGM2 Antibody [NBP1-86952] - Analysis using Anti-TGM2 antibody NBP1-86952 (A) shows similar pattern to independent antibody NBP1-86951 (B).
Transglutaminase 2/TGM2 Antibody - BSA Free Western Blot: Transglutaminase 2/TGM2 Antibody - BSA Free [NBP1-86952]

Western Blot: Transglutaminase 2/TGM2 Antibody - BSA Free [NBP1-86952]

Analysis in human cell line CAPAN-2.

Applications for Transglutaminase 2/TGM2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Transglutaminase 2/TGM2

TGase II is implicated in programmed cell death, signal transduction, drugresistance, cell growth, endocytosis, insulin secretion, cell adhesion, cataract formation, and wound healing.

Alternate Names

TGC, TGM2, Transglutaminase 2, tTG

Gene Symbol

TGM2

Additional Transglutaminase 2/TGM2 Products

Product Documents for Transglutaminase 2/TGM2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Transglutaminase 2/TGM2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Transglutaminase 2/TGM2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Transglutaminase 2/TGM2 Antibody - BSA Free and earn rewards!

Have you used Transglutaminase 2/TGM2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...