TTC11 Antibody (6S1G4)

Novus Biologicals | Catalog # NBP3-15848

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Knockout Validated, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6S1G4 expressed in HEK293
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-122 of human TTC11 (NP_057152.2).

Sequence:
MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDG

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TTC11 Antibody (6S1G4)

Knockout Validated: TTC11 Antibody (6S1G4) [NBP3-15848]

Western Blot: TTC11 Antibody (6S1G4) [NBP3-15848]

Western Blot: TTC11 Antibody (6S1G4) [NBP3-15848] - Western blot analysis of extracts from normal (control) and TTC11 knockout (KO) HeLa cells, using TTC11 antibody (NBP3-15848) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunoprecipitation: TTC11 Antibody (6S1G4) [NBP3-15848]

Immunoprecipitation: TTC11 Antibody (6S1G4) [NBP3-15848]

Immunoprecipitation: TTC11 Antibody (6S1G4) [NBP3-15848] - Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug TTC11 antibody (NBP3-15848). Western blot was performed from the immunoprecipitate using TTC11 antibody (NBP3-15848) at a dilition of 1:1000.
TTC11 Antibody (6S1G4)

Western Blot: TTC11 Antibody (6S1G4) [TTC11] -

Western Blot: TTC11 Antibody (6S1G4) [TTC11] - Western blot analysis of various lysates, using [KO Validated] TTC11 Rabbit mAb at 1:1000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
TTC11 Antibody (6S1G4)

Immunohistochemistry: TTC11 Antibody (6S1G4) [TTC11] -

Immunohistochemistry: TTC11 Antibody (6S1G4) [TTC11] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using [KO Validated] TTC11 Rabbit mAb at a dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
TTC11 Antibody (6S1G4)

Immunohistochemistry: TTC11 Antibody (6S1G4) [TTC11] -

Immunohistochemistry: TTC11 Antibody (6S1G4) [TTC11] - Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using [KO Validated] TTC11 Rabbit mAb at a dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
TTC11 Antibody (6S1G4)

Immunocytochemistry/ Immunofluorescence: TTC11 Antibody (6S1G4) [TTC11] -

Immunocytochemistry/ Immunofluorescence: TTC11 Antibody (6S1G4) [TTC11] - Confocal imaging of U-2 OS cells using [KO Validated] TTC11 Rabbit mAb. The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 60x.

Applications for TTC11 Antibody (6S1G4)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL. Please optimize the concentration based on your specific assay requirements.

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Immunoprecipitation

0.5μg-4μg antibody for 200μg-400μg extracts of whole cells

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: TTC11

The balance between fission and fusion regulates the morphology of mitochondria. TTC11 is a component of a mitochondrial complex that promotes mitochondrial fission (James et al., 2003 [PubMed 12783892]).[supplied by OMIM]

Alternate Names

CGI-135, Fis1, FIS1 homolog, fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae), fission 1 (mitochondrial outer membrane) homolog (yeast), H_NH0132A01.6, hFis1, mitochondrial fission 1 protein, tetratricopeptide repeat domain 11, Tetratricopeptide repeat protein 11, TTC11TPR repeat protein 11

Gene Symbol

FIS1

Additional TTC11 Products

Product Documents for TTC11 Antibody (6S1G4)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TTC11 Antibody (6S1G4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for TTC11 Antibody (6S1G4)

There are currently no reviews for this product. Be the first to review TTC11 Antibody (6S1G4) and earn rewards!

Have you used TTC11 Antibody (6S1G4)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...