14-3-3 gamma Antibody (5R4Q4)

Novus Biologicals | Catalog # NBP3-16771

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 5R4Q4
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 100-200 of human 14-3-3 gamma (P61981). VLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTA

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for 14-3-3 gamma Antibody (5R4Q4)

Western Blot: 14-3-3 gamma Antibody (5R4Q4) [NBP3-16771]

Western Blot: 14-3-3 gamma Antibody (5R4Q4) [NBP3-16771]

Western Blot: 14-3-3 gamma Antibody (5R4Q4) [NBP3-16771] - Western blot analysis of extracts of various cell lines, using 14-3-3 gamma Rabbit mAb (NBP3-16771) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Immunohistochemistry-Paraffin: 14-3-3 gamma Antibody (5R4Q4) [NBP3-16771]

Immunohistochemistry-Paraffin: 14-3-3 gamma Antibody (5R4Q4) [NBP3-16771]

Immunohistochemistry-Paraffin: 14-3-3 gamma Antibody (5R4Q4) [NBP3-16771] - Immunohistochemistry of paraffin-embedded mouse brain using 14-3-3 gamma Rabbit mAb (NBP3-16771) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Applications for 14-3-3 gamma Antibody (5R4Q4)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: 14-3-3 gamma

14-3-3 protein gamma is a member of the 14-3-3 family of proteins which help mediate signal transduction. Specifically, 14-3-3 gamma is an adapter protein responsible for bringing signal transduction to completion. It therefore plays an important role in regulating many fundamental cellular processes, such as apoptosis and cell-cycle checkpoints.

Signal-induced phosphorylation has the ability to change protein function, however phosphorylation is not always enough to change a protein's function. 14-3-3 gamma has the ability to bind a large number of target proteins thereby affecting the proteins' activity and/or function.

14-3-3 gamma is highly expressed in brain, heart and skeletal muscle, where it is induced by growth factors in human vascular smooth muscle cells. This suggests that 14-3-3 gamma may play a role in muscle tissue function.

Alternate Names

1433 gamma, YWHAG

Gene Symbol

YWHAG

Additional 14-3-3 gamma Products

Product Documents for 14-3-3 gamma Antibody (5R4Q4)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for 14-3-3 gamma Antibody (5R4Q4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for 14-3-3 gamma Antibody (5R4Q4)

There are currently no reviews for this product. Be the first to review 14-3-3 gamma Antibody (5R4Q4) and earn rewards!

Have you used 14-3-3 gamma Antibody (5R4Q4)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies