14-3-3 zeta/delta Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-92813

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 146-245 of human 14-3-3 zeta/delta (NP_003397.1). QQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for 14-3-3 zeta/delta Antibody - BSA Free

Western Blot: 14-3-3 zeta/delta AntibodyAzide and BSA Free [NBP2-92813]

Western Blot: 14-3-3 zeta/delta AntibodyAzide and BSA Free [NBP2-92813]

Western Blot: 14-3-3 zeta/delta Antibody [NBP2-92813] - Analysis of extracts of various cell lines, using 14-3-3 zeta/delta at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Immunohistochemistry-Paraffin: 14-3-3 zeta/delta Antibody - Azide and BSA Free [NBP2-92813]

Immunohistochemistry-Paraffin: 14-3-3 zeta/delta Antibody - Azide and BSA Free [NBP2-92813]

Immunohistochemistry-Paraffin: 14-3-3 zeta/delta Antibody [NBP2-92813] - Rat kidney using YWHAZ Rabbit pAb at dilution of 1:100 (40x lens).
14-3-3 zeta/delta Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: 14-3-3 zeta/delta Antibody - Azide and BSA Free [NBP2-92813] -

Immunocytochemistry/ Immunofluorescence: 14-3-3 zeta/delta Antibody - Azide and BSA Free [NBP2-92813] - Immunofluorescence analysis of paraffin-embedded Rat brain using 14-3-3 zeta/delta Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for 14-3-3 zeta/delta Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:200

Immunohistochemistry

1:50-1:200

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: 14-3-3 zeta/delta

14-3-3 proteins are highly conserved proteins which play a role in both signal transduction and progression through the cell cycle by binding to and regulating several different proteins. 14-3-3 proteins activate tyrosine and tryptophan hydroxylases and protein kinase C. They mediate signal transduction by binding to phosphoserine-containing proteins. There are at least 7 mammalian isoforms: alpha, beta, gamma, delta, epsilon, zeta, and eta. An eighth subtype, termed theta has been found in rat brain. The 14-3-3 proteins exist in vitro and in vivo as either homo- or heterodimers which interact via their N-terminal domains and are subject to phosphorylation by protein kinase C. 14-3-3 proteins are localized in the cytoplasm of neurons in the cerebral cortex and are axonally transported to the nerve terminals. They may be present at lower levels in various other eukaryotic tissues. Northern blot analysis has shown expression of the eta chain in cultured cell lines derived from various tumors.

Alternate Names

KCIP-1MGC126532,14-3-3-zeta, MGC111427, MGC138156, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, deltapolypeptide, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zetapolypeptide, zeta polypeptide

Gene Symbol

YWHAZ

Additional 14-3-3 zeta/delta Products

Product Documents for 14-3-3 zeta/delta Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for 14-3-3 zeta/delta Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for 14-3-3 zeta/delta Antibody - BSA Free

There are currently no reviews for this product. Be the first to review 14-3-3 zeta/delta Antibody - BSA Free and earn rewards!

Have you used 14-3-3 zeta/delta Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...