5-Lipoxygenase Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56011

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (94%), Rat (94%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all 5-Lipoxygenase Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKYWLNDDWY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for 5-Lipoxygenase Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: 5-Lipoxygenase Antibody [NBP2-56011]

Immunocytochemistry/ Immunofluorescence: 5-Lipoxygenase Antibody [NBP2-56011]

Immunocytochemistry/Immunofluorescence: 5-Lipoxygenase Antibody [NBP2-56011] - Staining of human cell line RT4 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: 5-Lipoxygenase Antibody [NBP2-56011]

Immunohistochemistry-Paraffin: 5-Lipoxygenase Antibody [NBP2-56011]

Immunohistochemistry-Paraffin: 5-Lipoxygenase Antibody [NBP2-56011] - Analysis in human spleen and skeletal muscle tissues using NBP2-56011 antibody. Corresponding ALOX5 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: 5-Lipoxygenase Antibody [NBP2-56011]

Immunohistochemistry-Paraffin: 5-Lipoxygenase Antibody [NBP2-56011]

Immunohistochemistry-Paraffin: 5-Lipoxygenase Antibody [NBP2-56011] - Staining of human spleen shows high expression.
Immunohistochemistry-Paraffin: 5-Lipoxygenase Antibody [NBP2-56011]

Immunohistochemistry-Paraffin: 5-Lipoxygenase Antibody [NBP2-56011]

Immunohistochemistry-Paraffin: 5-Lipoxygenase Antibody [NBP2-56011] - Staining of human lung shows strong nuclear positivity in macrophages.
Immunohistochemistry-Paraffin: 5-Lipoxygenase Antibody [NBP2-56011]

Immunohistochemistry-Paraffin: 5-Lipoxygenase Antibody [NBP2-56011]

Immunohistochemistry-Paraffin: 5-Lipoxygenase Antibody [NBP2-56011] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: 5-Lipoxygenase Antibody [NBP2-56011]

Immunohistochemistry-Paraffin: 5-Lipoxygenase Antibody [NBP2-56011]

Immunohistochemistry-Paraffin: 5-Lipoxygenase Antibody [NBP2-56011] - Staining of human small intestine shows strong nuclear positivity in lymphoid cells.

Applications for 5-Lipoxygenase Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: 5-Lipoxygenase

5 Lipoxygenase encodes a protein which, with Arachidonate 5-lipoxygenase-activating protein, is required for leukotriene synthesis. Leukotrienes are arachidonic acid metabolites which have been implicated in various types of inflammatory responses, including asthma, arthritis and psoriasis. This protein localizes to the plasma membrane. Inhibitors of its function impede translocation of 5-lipoxygenase from the cytoplasm to the cell membrane and inhibit 5-lipoxygenase activation.

Alternate Names

5Lipoxygenase, 5LPG, ALOX5, LOG5, LOX5A

Gene Symbol

ALOX5

Additional 5-Lipoxygenase Products

Product Documents for 5-Lipoxygenase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for 5-Lipoxygenase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for 5-Lipoxygenase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review 5-Lipoxygenase Antibody - BSA Free and earn rewards!

Have you used 5-Lipoxygenase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies