A20/TNFAIP3 Antibody (0K8B0)

Novus Biologicals | Catalog # NBP3-15681

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 0K8B0 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 450-550 of human A20/TNFAIP3 (P21580). PEESTGGPHSAPPTAPSPFLFSETTAMKCRSPGCPFTLNVQHNGFCERCHNARQLHASHAPDHTRHLDPGKCQACLQDVTRTFNGICSTCFKRTTAEASSS

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

90 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for A20/TNFAIP3 Antibody (0K8B0)

Western Blot: A20/TNFAIP3 Antibody (0K8B0) [NBP3-15681]

Western Blot: A20/TNFAIP3 Antibody (0K8B0) [NBP3-15681]

Western Blot: A20/TNFAIP3 Antibody (0K8B0) [NBP3-15681] - Western blot analysis of extracts of various cell lines, using A20/TNFAIP3 antibody (NBP3-15681) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.
Immunohistochemistry-Paraffin: A20/TNFAIP3 Antibody (0K8B0) [NBP3-15681]

Immunohistochemistry-Paraffin: A20/TNFAIP3 Antibody (0K8B0) [NBP3-15681]

Immunohistochemistry-Paraffin: A20/TNFAIP3 Antibody (0K8B0) [NBP3-15681] - Immunohistochemistry of paraffin-embedded human colon carcinoma using A20/TNFAIP3 Rabbit mAb (NBP3-15681) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Applications for A20/TNFAIP3 Antibody (0K8B0)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: A20/TNFAIP3

A20, TNFalpha-induced protein 3, TNFAIP3 (theoretical molecular weight 95 kDa) is an important regulator of pro-inflammatory signaling pathways such as NF-kB activation and tumor necrosis factor (TNF)-mediated programmed cell death (1, 2). In macrophages, A20/TNFAIP3 controls the release of IL-1 beta/IL-18 by regulating NLRP3 inflammasome activity and CXCL9/CXCL10 production via STAT1 signaling. By regulating the expression of inflammatory molecules such as IL-6 and anti-apoptotic proteins in dendritic cells, A20/TNFAIP3 maintains T-cell and B-cell homeostasis.

A20/TNFAIP3 is a highly conserved protein sharing >90% amino acid sequence identity across various mammalian species and is highly expressed in T-cell and B-cells. Coding and non-coding single nucleotide polymorphisms (SNPs) of A20/TNFAIP3 have been associated with multiple autoinflammatory and autoimmune diseases including type 1 diabetes, rheumatoid arthritis, Crohn's disease, and systemic lupus erythematosus (SLE) (3). The two domains of A20/TNFAIP3 cooperate to regulate NF-kB signaling. Its N-terminal ovarian tumor (OTU) domain contains a catalytic cysteine (C103) which functions as a K63 deubiquitinase, whereas the 7 zinc fingers that make up the C-terminal domain mediate K48 polyubiquitination. To regulate NF-kB signaling, A20/TNFAIP3 removes K63-polyubiquitin chains from receptor-interacting protein 1 (RIP1) and NF-kB essential modulator (NEMO), thus preventing interactions with downstream partners. A20/TNFAIP3 also contributes to the degradation of RIP1 and Ubc13 through the addition of K48 polyubiquitin chains (4).

References

1.Dixit VM1, Green S, Sarma V, Holzman LB, Wolf FW, O'Rourke K, Ward PA, Prochownik EV, Marks RM. (1990) Tumor necrosis factor-alpha induction of novel gene products in human endothelial cells including a macrophage-specific chemotaxin. J Biol Chem. 265(5):2973-8. PMID: 2406243

2.Verstrepen L, Verhelst K, van Loo G, Carpentier I, Ley SC, Beyaert R. (2010) Expression, biological activities and mechanisms of action of A20 (TNFAIP3). Biochem Pharmacol. 80(12):2009-20. PMID: 20599425

3.Mele A, Cervantes JR, Chien V, Friedman D, Ferran C. (2014) Single nucleotide polymorphisms at the TNFAIP3/A20 locus and susceptibility/resistance to inflammatory and autoimmune diseases. Adv Exp Med Biol. 809:163-83. PMID: 25302371

4.Das T, Chen Z, Hendriks RW, Kool M. (2018) A20/Tumor Necrosis Factor alpha-Induced Protein 3 in Immune Cells Controls Development of Autoinflammation and Autoimmunity: Lessons from Mouse Models. Front Immunol. 9:104. PMID: 29515565

Alternate Names

OTUD7C, TNFA1P2, TNFAIP3

Gene Symbol

TNFAIP3

Additional A20/TNFAIP3 Products

Product Documents for A20/TNFAIP3 Antibody (0K8B0)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for A20/TNFAIP3 Antibody (0K8B0)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for A20/TNFAIP3 Antibody (0K8B0)

There are currently no reviews for this product. Be the first to review A20/TNFAIP3 Antibody (0K8B0) and earn rewards!

Have you used A20/TNFAIP3 Antibody (0K8B0)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for A20/TNFAIP3 Antibody (0K8B0)

Showing  1 - 1 of 1 FAQ Showing All
  • Q: Following cleavage of A20/TNFAIP3, two full length fragments are released, one with 37 kDa and other one was approx. at 52 kDa. There are mentioning of 75Kda fragment and 37 KDa fragment in scientific papers but not 52 KDa. What is the significance of that specific band?

    A: There is data available that explains 52 KDa band in A20/TNFAIP3. Using this antibody in Western Blot will result multiple bands. In LPS treatment, 52 KDa putative cleavage band was observed; however, the same band was not found in untreated THP1 cells.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...