ABCA8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91641

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ABCA8 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KEVLGLPDEESIKEFTANYPEEIVRVTFTNTYSYHLKFLLGHGMPAKKEHKDHTAHCYETNEDVYCEVSVFWKEGFVA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ABCA8 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ABCA8 Antibody [NBP1-91641]

Immunocytochemistry/ Immunofluorescence: ABCA8 Antibody [NBP1-91641]

Immunocytochemistry/Immunofluorescence: ABCA8 Antibody [NBP1-91641] - Staining of human cell line ASC TERT1 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: ABCA8 Antibody [NBP1-91641]

Immunohistochemistry-Paraffin: ABCA8 Antibody [NBP1-91641]

Immunohistochemistry-Paraffin: ABCA8 Antibody [NBP1-91641] - Staining of human ovary shows high expression.
ABCA8 Antibody - BSA Free Immunohistochemistry: ABCA8 Antibody - BSA Free [NBP1-91641]

Immunohistochemistry: ABCA8 Antibody - BSA Free [NBP1-91641]

Staining of human pancreas shows low expression as expected.
ABCA8 Antibody - BSA Free Immunohistochemistry: ABCA8 Antibody - BSA Free [NBP1-91641]

Immunohistochemistry: ABCA8 Antibody - BSA Free [NBP1-91641]

Staining of human ovary shows high expression.
ABCA8 Antibody - BSA Free Immunohistochemistry: ABCA8 Antibody - BSA Free [NBP1-91641]

Immunohistochemistry: ABCA8 Antibody - BSA Free [NBP1-91641]

Analysis in human ovary and pancreas tissues using Anti-ABCA8 antibody. Corresponding ABCA8 RNA-seq data are presented for the same tissues.

Applications for ABCA8 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ABCA8

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. The function of this protein has not yet been determined. [provided by RefSeq]

Alternate Names

ATP-binding cassette sub-family A member 8, ATP-binding cassette, sub-family A (ABC1), member 8, EC 3.6.3, EC 3.6.3.41, KIAA0822MGC163152

Entrez Gene IDs

10351 (Human)

Gene Symbol

ABCA8

UniProt

O94911 (Human)

Additional ABCA8 Products

Product Documents for ABCA8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ABCA8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ABCA8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ABCA8 Antibody - BSA Free and earn rewards!

Have you used ABCA8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies