ABCC9 Antibody (S319A-14) - BSA Free

Novus Biologicals | Catalog # NBP2-22403

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Rat

Applications

Validated:

Immunohistochemistry, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2A Clone # S319A-14

Format

BSA Free
View all ABCC9 Primary Antibodies »

Product Specifications

Immunogen

Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A

Localization

Membrane

Specificity

Detects approx 120kDa. Does not cross-react with SUR2B.

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2A

Scientific Data Images for ABCC9 Antibody (S319A-14) - BSA Free

Western Blot: ABCC9 Antibody (S319A-14) [NBP2-22403]

Western Blot: ABCC9 Antibody (S319A-14) [NBP2-22403]

Western Blot: ABCC9 Antibody (S319A-14) [NBP2-22403] - Western Blot analysis of Rat Brain Membrane showing detection of ~120 kDa ABCC9 protein using Mouse Anti-ABCC9 Monoclonal Antibody, Clone S319A-14 (NBP2-22403). Lane 1: MW Ladder. Lane 2: Rat Brain Membrane (10 ug).. Load: 10 ug. Block: 5% milk. Primary Antibody: Mouse Anti-ABCC9 Monoclonal Antibody (NBP2-22403) at 1:1000 for 1 hour at RT. Secondary Antibody: Goat Anti-Mouse IgG: HRP at 1:200 for 1 hour at RT. Color Development: TMB solution for 10 min at RT. Predicted/Observed Size: ~120 kDa.
Immunocytochemistry/ Immunofluorescence: ABCC9 Antibody (S319A-14) [NBP2-22403]

Immunocytochemistry/ Immunofluorescence: ABCC9 Antibody (S319A-14) [NBP2-22403]

Immunocytochemistry/Immunofluorescence: ABCC9 Antibody (S319A-14) [NBP2-22403] - Immunocytochemistry/Immunofluorescence analysis using Mouse Anti-ABCC9 Monoclonal Antibody, Clone S319A-14 (NBP2-22403). Tissue: Neuroblastoma cells (SH-SY5Y). Species: Human. Fixation: 4% PFA for 15 min. Primary Antibody: Mouse Anti-ABCC9 Monoclonal Antibody (NBP2-22403) at 1:200 for overnight at 4C with slow rocking. Secondary Antibody: AlexaFluor 488 at 1:1000 for 1 hour at RT. Counterstain: Phalloidin-iFluor 647 (red) F-Actin stain; Hoechst (blue) nuclear stain at 1:800, 1.6mM for 20 min at RT. (A) Hoechst (blue) nuclear stain. (B) Phalloidin-iFluor 647 (red) F-Actin stain. (C) ABCC9 Antibody (D) Composite.
Immunocytochemistry/ Immunofluorescence: ABCC9 Antibody (S319A-14) [NBP2-22403]

Immunocytochemistry/ Immunofluorescence: ABCC9 Antibody (S319A-14) [NBP2-22403]

Immunocytochemistry/Immunofluorescence: ABCC9 Antibody (S319A-14) [NBP2-22403] - Tissue: Neuroblastoma cell line SK-N-BE. Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-SUR2A Monoclonal Antibody at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:100 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000, 1:5000 for 60min RT, 5min RT. Localization: Membrane. Magnification: 60X.
Immunocytochemistry/ Immunofluorescence: ABCC9 Antibody (S319A-14) [NBP2-22403]

Immunocytochemistry/ Immunofluorescence: ABCC9 Antibody (S319A-14) [NBP2-22403]

Immunocytochemistry/Immunofluorescence: ABCC9 Antibody (S319A-14) [NBP2-22403] - Immunocytochemistry/Immunofluorescence analysis using Mouse Anti-ABCC9 Monoclonal Antibody, Clone S319A-14 (NBP2-22403). Tissue: Neuroblastoma cell line (SK-N-BE). Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-ABCC9 Monoclonal Antibody (NBP2-22403) at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:100 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000, 1:5000 for 60min RT, 5min RT. Localization: Membrane. Magnification: 60X. (A) DAPI (blue) nuclear stain. (B) Phalloidin Texas Red F-Actin stain. (C) ABCC9 Antibody. (D) Composite.

Applications for ABCC9 Antibody (S319A-14) - BSA Free

Application
Recommended Usage

Western Blot

1:1000
Application Notes
1 ug/ml of SUR2A Antibody was sufficient for detection of SUR2A in 20 ug of mouse brain membrane lysate and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary Antibody.

Formulation, Preparation, and Storage

Purification

Protein G purified

Formulation

PBS (pH 7.4), 50% Glycerol

Format

BSA Free

Preservative

0.1% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ABCC9

The protein encoded by the ABCC9 gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is thought to form ATP-sensitive potassium channels in cardiac, skeletal, and vascular and non-vascular smooth muscle. Protein structure suggests a role as the drug-binding channel-modulating subunit of the extrapancreatic ATP-sensitive potassium channels. No disease has been associated with this gene thus far. Alternative splicing of this gene results in several products, two of which result from differential usage of two terminal exons and one of which results from exon deletion. (provided by RefSeq)

Long Name

ATP-binding cassette sub-family C member 9

Alternate Names

SUR2

Gene Symbol

ABCC9

UniProt

P70170 (Mouse)

Additional ABCC9 Products

Product Documents for ABCC9 Antibody (S319A-14) - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ABCC9 Antibody (S319A-14) - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for ABCC9 Antibody (S319A-14) - BSA Free

Customer Reviews for ABCC9 Antibody (S319A-14) - BSA Free

There are currently no reviews for this product. Be the first to review ABCC9 Antibody (S319A-14) - BSA Free and earn rewards!

Have you used ABCC9 Antibody (S319A-14) - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies