Acetyl-coenzyme A transporter 1 Antibody (3A4) - Azide and BSA Free

Novus Biologicals | Catalog # H00009197-M07

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat, Hamster

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 3A4

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

SLC33A1 (NP_004724, 1 a.a. ~ 69 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSPTISHKDSSRQRRPGNFSHSLDMKSGPLPPGGWDDSHLDSAGREGDREALLGDTGTGDFLKAPQSFR

Specificity

SLC33A1 (3A4)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for Acetyl-coenzyme A transporter 1 Antibody (3A4) - Azide and BSA Free

Western Blot: Acetyl-coenzyme A transporter 1 Antibody (3A4) [H00009197-M07]

Western Blot: Acetyl-coenzyme A transporter 1 Antibody (3A4) [H00009197-M07]

Western Blot: Acetyl-coenzyme A transporter 1 Antibody (3A4) [H00009197-M07] - Analysis of SLC33A1 expression in PC-12 (Cat # L012V1).
Western Blot: Acetyl-coenzyme A transporter 1 Antibody (3A4) [H00009197-M07]

Western Blot: Acetyl-coenzyme A transporter 1 Antibody (3A4) [H00009197-M07]

Western Blot: Acetyl-coenzyme A transporter 1 Antibody (3A4) [H00009197-M07] - Western blot analysis of SLC33A1 over-expressed 293 cell line, cotransfected with SLC33A1 Validated Chimera RNAi or non-transfected control. Blot probed with H00009197-M07. GAPDH (36.1 kDa) used as loading control.
Western Blot: Acetyl-coenzyme A transporter 1 Antibody (3A4) [H00009197-M07]

Western Blot: Acetyl-coenzyme A transporter 1 Antibody (3A4) [H00009197-M07]

Western Blot: Acetyl-coenzyme A transporter 1 Antibody (3A4) [H00009197-M07] - Analysis of SLC33A1 expression in transfected 293T cell line by SLC33A1 monoclonal antibody (M07), clone 3A4. Lane 1: SLC33A1 transfected lysatE (60.9 KDa). Lane 2: Non-transfected lysate.
ELISA: Acetyl-coenzyme A transporter 1 Antibody (3A4) [H00009197-M07]

ELISA: Acetyl-coenzyme A transporter 1 Antibody (3A4) [H00009197-M07]

ELISA: Acetyl-coenzyme A transporter 1 Antibody (3A4) [H00009197-M07] - Detection limit for recombinant GST tagged SLC33A1 is 0.03 ng/ml as a capture antibody.

Applications for Acetyl-coenzyme A transporter 1 Antibody (3A4) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. It has also been used for ELISA and RNAi validation.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Acetyl-coenzyme A transporter 1

The encoded protein is required for the formation of O-acetylated (Ac) gangliosides. It is predicted to contain 6 to 10 transmembrane domains, and a leucine zipper motif in transmembrane domain III. Studies indicate that the protein is localized to the cytoplasm.

Alternate Names

ACATNAcetyl-CoA transporter 1, acetyl-Coenzyme A transporter, AT-1acetyl-coenzyme A transporter 1, AT1SPG42, solute carrier family 33 (acetyl-CoA transporter), member 1, Solute carrier family 33 member 1, spastic paraplegia 42 (autosomal dominant)

Entrez Gene IDs

9197 (Human)

Gene Symbol

SLC33A1

OMIM

603690 (Human)

Additional Acetyl-coenzyme A transporter 1 Products

Product Documents for Acetyl-coenzyme A transporter 1 Antibody (3A4) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Acetyl-coenzyme A transporter 1 Antibody (3A4) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Acetyl-coenzyme A transporter 1 Antibody (3A4) - Azide and BSA Free

Customer Reviews for Acetyl-coenzyme A transporter 1 Antibody (3A4) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Acetyl-coenzyme A transporter 1 Antibody (3A4) - Azide and BSA Free and earn rewards!

Have you used Acetyl-coenzyme A transporter 1 Antibody (3A4) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...