Adenylate Kinase 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35344

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-194 of human Adenylate Kinase 1 (NP_000467.1).

Sequence:
MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Adenylate Kinase 1 Antibody - BSA Free

Adenylate Kinase 1 Antibody

Immunohistochemistry: Adenylate Kinase 1 Antibody [NBP3-35344] -

Immunohistochemistry: Adenylate Kinase 1 Antibody [NBP3-35344] - Immunohistochemistry analysis of paraffin-embedded Mouse heart using Adenylate Kinase 1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Adenylate Kinase 1 Antibody

Immunohistochemistry: Adenylate Kinase 1 Antibody [NBP3-35344] -

Immunohistochemistry: Adenylate Kinase 1 Antibody [NBP3-35344] - Immunohistochemistry analysis of paraffin-embedded Human esophagus using Adenylate Kinase 1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Adenylate Kinase 1 Antibody

Western Blot: Adenylate Kinase 1 Antibody [NBP3-35344] -

Western Blot: Adenylate Kinase 1 Antibody [NBP3-35344] - Western blot analysis of various lysates using Adenylate Kinase 1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Adenylate Kinase 1 Antibody

Immunohistochemistry: Adenylate Kinase 1 Antibody [NBP3-35344] -

Immunohistochemistry: Adenylate Kinase 1 Antibody [NBP3-35344] - Immunohistochemistry analysis of paraffin-embedded Rat kidney using Adenylate Kinase 1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Applications for Adenylate Kinase 1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Adenylate Kinase 1

Adenylate kinase is an enzyme involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate group among adinine nucleotides. Three isozymes of adenylate kinase have been identified in vertebrates, adenylate isozyme 1 (AK1), 2 (AK2) and 3 (AK3). AK1 is found in the cytosol of skeletal muscle, brain and erythrocytes, whereas AK2 and AK3 are found in the mitochondria of other tissues including liver and heart. AK1 was identified because of its association with a rare genetic disorder causing nonspherocytic hemolytic anemia where a mutation in the AK1 gene was found to reduce the catalytic activity of the enzyme.

Long Name

Adenylate kinase isoenzyme 1

Alternate Names

AK 1, AK1, EC 2.7.4.3, EC 2.7.4.6, Myokinase

Gene Symbol

AK1

Additional Adenylate Kinase 1 Products

Product Documents for Adenylate Kinase 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Adenylate Kinase 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Adenylate Kinase 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Adenylate Kinase 1 Antibody - BSA Free and earn rewards!

Have you used Adenylate Kinase 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...