Adiponectin/Acrp30 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38657

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (92%), Rat (92%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: YMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit Adiponectin/Acrp30 Antibody - BSA Free (NBP2-38657) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Adiponectin/Acrp30 Antibody - BSA Free

Adiponectin/Acrp30 Antibody - BSA Free

Western Blot: Adiponectin/Acrp30 Antibody [NBP2-38657] -

Western Blot: Adiponectin/Acrp30 Antibody [NBP2-38657] -Analysis in human breast tissue.
Adiponectin/Acrp30 Antibody - BSA Free

Immunohistochemistry-Paraffin: Adiponectin/Acrp30 Antibody [NBP2-38657] -

Immunohistochemistry-Paraffin: Adiponectin/Acrp30 Antibody [NBP2-38657] -Staining of human skeletal muscle shows strong membranous positivity in myocytes.
Adiponectin/Acrp30 Antibody - BSA Free

Immunohistochemistry-Paraffin: Adiponectin/Acrp30 Antibody [NBP2-38657] -

Immunohistochemistry-Paraffin: Adiponectin/Acrp30 Antibody [NBP2-38657] - Staining of human endometrium shows strong membranous positivity in cells in endometrial stroma.
Adiponectin/Acrp30 Antibody - BSA Free

Immunohistochemistry-Paraffin: Adiponectin/Acrp30 Antibody [NBP2-38657] -

Immunohistochemistry-Paraffin: Adiponectin/Acrp30 Antibody [NBP2-38657] - Staining of human skin shows strong membranous positivity in basal squamous epithelial cells.
Adiponectin/Acrp30 Antibody - BSA Free

Immunohistochemistry-Paraffin: Adiponectin/Acrp30 Antibody [NBP2-38657] -

Immunohistochemistry-Paraffin: Adiponectin/Acrp30 Antibody [NBP2-38657] -Staining of human kidney shows strong membranous positivity in cells in glomeruli.

Applications for Adiponectin/Acrp30 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Adiponectin/Acrp30

Adipose cells produce and secrete numerous physiologically important proteins, such as Lipoprotein Lipase, Leptin, and Adipocyte Complement Related protein of 30 kDa, also known as Acrp30 or Adiponectin. Adiponectin is a circulating protein that is secreted exclusively by differentiated adipocytes. During adipocyte differentiation, Adiponectin mRNA is induced >100 fold. Adiponectin improves the ability of insulin to suppress glucose production, at sub physiological levels, thereby linking adipose tissue to whole body glucose regulation. Adiponectin function appears to be regulated by phosphatidylinositol 3 kinase (PI3K) since Adiponectin secretion is blocked by pharmacologic inhibitors of this kinase. Adiponectin mRNA is significantly reduced in adipose tissue of obese patients with Type 2 diabetes. The structural similarity of Adiponectin to TNF alpha suggests that Adiponectin may play a role in pathogenesis of insulin resistance in Type 2 diabetes. Adiponectin is implicated as a regulator of whole body energy homeostasis.

Alternate Names

Acrp30, AdipoQ, ApM1, GBP28

Gene Symbol

ADIPOQ

UniProt

Additional Adiponectin/Acrp30 Products

Product Documents for Adiponectin/Acrp30 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Adiponectin/Acrp30 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Adiponectin/Acrp30 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Adiponectin/Acrp30 Antibody - BSA Free and earn rewards!

Have you used Adiponectin/Acrp30 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies