alcohol dehydrogenase 5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49350

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Cited:

Human

Predicted:

Mouse (90%), Rat (92%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Simple Western

Cited:

Simple Western

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all alcohol dehydrogenase 5 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: GGWKSVESVPKLVSEYMSKKIKVDEFVTHNLSFDEINKAFELMHSGKSI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for alcohol dehydrogenase 5 Antibody - BSA Free

Western Blot: alcohol dehydrogenase 5 Antibody [NBP2-49350]

Western Blot: alcohol dehydrogenase 5 Antibody [NBP2-49350]

Western Blot: alcohol dehydrogenase 5 Antibody [NBP2-49350] - Analysis in control (vector only transfected HEK293T lysate) and ADH5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: alcohol dehydrogenase 5 Antibody [NBP2-49350]

Immunohistochemistry-Paraffin: alcohol dehydrogenase 5 Antibody [NBP2-49350]

Immunohistochemistry-Paraffin: alcohol dehydrogenase 5 Antibody [NBP2-49350] - Staining of human skeletal muscle shows low positivity in myocytes as expected.
Immunohistochemistry-Paraffin: alcohol dehydrogenase 5 Antibody [NBP2-49350]

Immunohistochemistry-Paraffin: alcohol dehydrogenase 5 Antibody [NBP2-49350]

Immunohistochemistry-Paraffin: alcohol dehydrogenase 5 Antibody [NBP2-49350] - Analysis in human endometrium and skeletal muscle tissues. Corresponding ADH5 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: alcohol dehydrogenase 5 Antibody [NBP2-49350]

Immunohistochemistry-Paraffin: alcohol dehydrogenase 5 Antibody [NBP2-49350]

Immunohistochemistry-Paraffin: alcohol dehydrogenase 5 Antibody [NBP2-49350] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: alcohol dehydrogenase 5 Antibody [NBP2-49350]

Immunohistochemistry-Paraffin: alcohol dehydrogenase 5 Antibody [NBP2-49350]

Immunohistochemistry-Paraffin: alcohol dehydrogenase 5 Antibody [NBP2-49350] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: alcohol dehydrogenase 5 Antibody [NBP2-49350]

Immunohistochemistry-Paraffin: alcohol dehydrogenase 5 Antibody [NBP2-49350]

Immunohistochemistry-Paraffin: alcohol dehydrogenase 5 Antibody [NBP2-49350] - Staining of human testis shows moderate to strong granular cytoplasmic positivity in Leydig cells.

Applications for alcohol dehydrogenase 5 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Validated in Simple Western (PMID: 32026202)
See Simple Western Antibody Database for Simple Western validation: separated by Size

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: alcohol dehydrogenase 5

The ADH5 gene encodes glutathione dependent formaldehyde dehydrogenase or class III alcohol dehydrogenase chi subunit, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, retinol, ethanol and other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class III alcohol dehydrogenase is a homodimer composed of 2 chi subunits. It has virtually no activity for ethanol oxidation, but exhibits high activity for oxidation of long chain primary alcohols and for oxidation of S hydroxymethyl glutathione, a spontaneous adduct between formaldehyde and glutathione. The enzyme is an important component of cellular metabolism for the elimination of formaldehyde, which is a potent irritant and sensitizing agent that causes rhinitis, lacrymation, contact dermatitis and pharyngitis.

Alternate Names

ADH-3, ADHXEC 1.1.1.1, alcohol dehydrogenase (class III), chi polypeptide, Alcohol dehydrogenase 5, alcohol dehydrogenase 5 (class III), chi polypeptide, Alcohol dehydrogenase class chi chain, alcohol dehydrogenase class-3, Alcohol dehydrogenase class-III, EC 1.1.1, EC 1.1.1.-, EC 1.1.1.284, FALDH, FDHGSNOR, formaldehyde dehydrogenase, Glutathione-dependent formaldehyde dehydrogenase, GSH-FDH, S-(hydroxymethyl)glutathione dehydrogenase

Gene Symbol

ADH5

Additional alcohol dehydrogenase 5 Products

Product Documents for alcohol dehydrogenase 5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for alcohol dehydrogenase 5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for alcohol dehydrogenase 5 Antibody - BSA Free

Customer Reviews for alcohol dehydrogenase 5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review alcohol dehydrogenase 5 Antibody - BSA Free and earn rewards!

Have you used alcohol dehydrogenase 5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies