Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-47551

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Aldehyde Dehydrogenase 3-A1/ALDH3A1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: NSGMGSYHGKKSFETFSHRRSCLVRPLMNDEGLKVRYPPSPAKMTQH

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody - BSA Free (NBP2-47551) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody [NBP2-47551]

Immunohistochemistry-Paraffin: Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody [NBP2-47551]

Immunohistochemistry-Paraffin: Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody [NBP2-47551] - Staining in human esophagus and colon tissues using anti-ALDH3A1 antibody. Corresponding ALDH3A1 RNA-seq data are presented for the same tissues.
Western Blot: Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody [NBP2-47551]

Western Blot: Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody [NBP2-47551]

Western Blot: Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody [NBP2-47551] - Analysis in human cell lines A-549 and U-251MG using anti-ALDH3A1 antibody. Corresponding ALDH3A1 RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Immunocytochemistry/ Immunofluorescence: Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody [NBP2-47551]

Immunocytochemistry/ Immunofluorescence: Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody [NBP2-47551]

Immunocytochemistry/Immunofluorescence: Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody [NBP2-47551] - Immunofluorescent staining of human cell line A549 shows localization to plasma membrane & cytosol.
Western Blot: Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody [NBP2-47551]

Western Blot: Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody [NBP2-47551]

Western Blot: Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody [NBP2-47551] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue.
Immunohistochemistry-Paraffin: Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody [NBP2-47551]

Immunohistochemistry-Paraffin: Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody [NBP2-47551]

Immunohistochemistry-Paraffin: Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody [NBP2-47551] - Staining of human colon shows low expression as expected.
Immunohistochemistry-Paraffin: Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody [NBP2-47551]

Immunohistochemistry-Paraffin: Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody [NBP2-47551]

Immunohistochemistry-Paraffin: Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody [NBP2-47551] - Staining of human esophagus shows high expression.

Applications for Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Aldehyde Dehydrogenase 3-A1/ALDH3A1

Aldehyde dehydrogenases oxidize various aldehydes to the corresponding acids. They are involved in the detoxification of alcohol-derived acetaldehyde and in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation. The enzyme encoded by this gene forms a cytoplasmic homodimer that preferentially oxidizes aromatic and medium-chain (6 carbons or more) saturated and unsaturated aldehyde substrates. It is thought to promote resistance to UV and 4-hydroxy-2-nonenal-induced oxidative damage in the cornea. The gene is located within the Smith-Magenis syndrome region on chromosome 17. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq]

Alternate Names

Aldehyde Dehydrogenase 3A1, ALDH3A1, ALDHIII

Gene Symbol

ALDH3A1

Additional Aldehyde Dehydrogenase 3-A1/ALDH3A1 Products

Product Documents for Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Redox Enzymes

Customer Reviews for Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody - BSA Free and earn rewards!

Have you used Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies